Property Summary

NCBI Gene PubMed Count 52
PubMed Score 182.80
PubTator Score 114.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Multiple myeloma 1.164 2.1e-03
astrocytoma -3.300 7.3e-18
ependymoma -6.300 2.1e-27
oligodendroglioma -3.400 7.5e-15
psoriasis -2.700 3.4e-03
glioblastoma -4.800 2.1e-05
osteosarcoma -1.499 1.2e-02
group 3 medulloblastoma -2.800 3.8e-03
atypical teratoid / rhabdoid tumor -5.600 7.7e-07
medulloblastoma, large-cell -3.100 3.0e-04
Duchenne muscular dystrophy -1.233 3.6e-03
limb girdle muscular dystrophy 2I -1.327 1.8e-02
autosomal dominant Emery-Dreifuss muscul... -1.463 3.2e-02
Becker muscular dystrophy -1.425 3.6e-02
tuberculosis 1.500 2.8e-09
adult high grade glioma -4.900 2.3e-07
pilocytic astrocytoma -5.600 5.4e-14
gastric carcinoma 1.200 3.4e-03
invasive ductal carcinoma -1.500 1.6e-03
ovarian cancer -1.900 1.2e-05

Gene RIF (24)

PMID Text
26866982 Results show that marker rs218966 in gene PHF14 and rs9836027 in MAP4 significantly associated with hypertension; additionally, rare variants in SNUPN significantly associated with systolic blood pressure.
25746230 We demonstrated that the MAP4 (Ser696 and Ser787) phosphorylation increased concomitantly with the p38/MAPK pathway activation by the LPS and TNF-alpha stimulation of HPMECs, which induced MT disassembly followed by hyperpermeability.
25631074 Cellular biotinylated microtubule-associated protein 4 (MAP4) is incorporated into HIV-1 Gag virus-like particles
25323976 Results demonstrated that MAP4 mutations contribute to the clinical spectrum of centrosomal defects and confirmed the complex role of a centrosomal protein in centrosomal, ciliary, and Golgi regulation associated with severe short stature.
25010285 Cellular biotinylated microtubule-associated protein 4 (MAP4) is incorporated into HIV-1 Gag virus-like particles
24140250 Data show that cAMP/alpha isoform of the catalytic subunit of human PKA (PKAc-alpha) signaling can disrupt microtubule (MT) cytoskeleton by the phosphorylation of microtubule-Associated Protein 4 (MAP4).
23572511 MAP4, which is a binding partner of SEPT2.
22164227 there are two possible mechanisms triggered by MAP4: stabilization of MT networks; DYNLT1 modulation, which is connected with VDAC1, and inhibition of hypoxia-induced mitochondrial permeabilization
22018492 DNAL1 and MAP4 may exert their functions in the HIV life cycle at reverse transcription, prior to nuclear translocation.
22018492 Knockdown of microtubule-associated protein 4 (MAP4) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
21822276 Data show that the tau-related protein MAP4 and the microtubule rescue factor CLASP1 are essential for maintaining spindle position and the correct cell-division axis.
19834535 Observational study of gene-disease association. (HuGE Navigator)
19367581 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18854154 Knockdown of microtubule-associated protein 4 (MAP4) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18613117 Data found the ratio of MAP4 to stathmin mRNA was found to be higher in diseased lung tissues compared to normal lung tissues, suggesting this ratio might also be used as a clinically relevant biomarker for NSCLCs.
18187620 Knockdown of microtubule-associated protein 4 (MAP4) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
16804917 This first report of a genetic alteration involving MAP4 points to a potentially relevant target gene in diffuse large B-cell lymphoma.
16093351 mAP4 interaction with septins modulates microtubule dynamics.
15840946 Truncation of the projection domain of MAP4 leads to attenuation of microtubule dynamic instability.
15528234 MAP4 microtubule decoration interferes with beta-adrenergic receptor recycling and that this may be one mechanism for beta-adrenergic receptor downregulation in heart failure.
14527689 adenovirus 2 E1B-55K protein blocks p53 as a transcriptional repressor protein of the survivin and the MAP4 promoters
12890753 activity of MAP4 is downregulated by reduced free tubulin concentrations
12123579 demonstrate that ectopic MAP4 promotes outgrowth of extended MTs during beta1-integrin-induced cell spreading
12079337 Results suggest that structural features of the PJ domain of MAP4 may contribute to the formation of a radial array of microtubules in proliferating cells.

AA Sequence

MADLSLADALTEPSPDIEGEIKRDFIATLEAEAFDDVVGETVGKTDYIPLLDVDEKTGNSESKKKPCSET      1 - 70
SQIEDTPSSKPTLLANGGHGVEGSDTTGSPTEFLEEKMAYQEYPNSQNWPEDTNFCFQPEQVVDPIQTDP     71 - 140
FKMYHDDDLADLVFPSSATADTSIFAGQNDPLKDSYGMSPCNTAVVPQGWSVEALNSPHSESFVSPEAVA    141 - 210
EPPQPTAVPLELAKEIEMASEERPPAQALEIMMGLKTTDMAPSKETEMALAKDMALATKTEVALAKDMES    211 - 280
PTKLDVTLAKDMQPSMESDMALVKDMELPTEKEVALVKDVRWPTETDVSSAKNVVLPTETEVAPAKDVTL    281 - 350
LKETERASPIKMDLAPSKDMGPPKENKKETERASPIKMDLAPSKDMGPPKENKIVPAKDLVLLSEIEVAQ    351 - 420
ANDIISSTEISSAEKVALSSETEVALARDMTLPPETNVILTKDKALPLEAEVAPVKDMAQLPETEIAPAK    421 - 490
DVAPSTVKEVGLLKDMSPLSETEMALGKDVTPPPETEVVLIKNVCLPPEMEVALTEDQVPALKTEAPLAK    491 - 560
DGVLTLANNVTPAKDVPPLSETEATPVPIKDMEIAQTQKGISEDSHLESLQDVGQSAAPTFMISPETVTG    561 - 630
TGKKCSLPAEEDSVLEKLGERKPCNSQPSELSSETSGIARPEEGRPVVSGTGNDITTPPNKELPPSPEKK    631 - 700
TKPLATTQPAKTSTSKAKTQPTSLPKQPAPTTIGGLNKKPMSLASGLVPAAPPKRPAVASARPSILPSKD    701 - 770
VKPKPIADAKAPEKRASPSKPASAPASRSGSKSTQTVAKTTTAAAVASTGPSSRSPSTLLPKKPTAIKTE    771 - 840
GKPAEVKKMTAKSVPADLSRPKSTSTSSMKKTTTLSGTAPAAGVVPSRVKATPMPSRPSTTPFIDKKPTS    841 - 910
AKPSSTTPRLSRLATNTSAPDLKNVRSKVGSTENIKHQPGGGRAKVEKKTEAAATTRKPESNAVTKTAGP    911 - 980
IASAQKQPAGKVQIVSKKVSYSHIQSKCGSKDNIKHVPGGGNVQIQNKKVDISKVSSKCGSKANIKHKPG    981 - 1050
GGDVKIESQKLNFKEKAQAKVGSLDNVGHLPAGGAVKTEGGGSEAPLCPGPPAGEEPAISEAAPEAGAPT   1051 - 1120
SASGLNGHPTLSGGGDQREAQTLDSQIQETSI                                         1121 - 1152
//

Text Mined References (70)

PMID Year Title
26866982 2016 Filtering genetic variants and placing informative priors based on putative biological function.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25746230 2015 P38/MAPK contributes to endothelial barrier dysfunction via MAP4 phosphorylation-dependent microtubule disassembly in inflammation-induced acute lung injury.
25323976 2015 MAP4-dependent regulation of microtubule formation affects centrosome, cilia, and Golgi architecture as a central mechanism in growth regulation.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24140250 2014 Activation of cyclic AMP/PKA pathway inhibits bladder cancer cell invasion by targeting MAP4-dependent microtubule dynamics.
23572511 2013 Septins 2, 7 and 9 and MAP4 colocalize along the axoneme in the primary cilium and control ciliary length.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22164227 2011 MAP4 mechanism that stabilizes mitochondrial permeability transition in hypoxia: microtubule enhancement and DYNLT1 interaction with VDAC1.
22018492 2012 Knockdown of MAP4 and DNAL1 produces a post-fusion and pre-nuclear translocation impairment in HIV-1 replication.
21909110 2011 Genome-wide association study identifies six new loci influencing pulse pressure and mean arterial pressure.
21822276 2011 MAP4 and CLASP1 operate as a safety mechanism to maintain a stable spindle position in mitosis.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19367581 2010 Identification of neuroglycan C and interacting partners as potential susceptibility genes for schizophrenia in a Southern Chinese population.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18613117 2008 Beta-tubulin isotype classes II and V expression patterns in nonsmall cell lung carcinomas.
18088087 2008 Phosphoproteome of resting human platelets.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17693683 2007 Quantitative phosphoproteome profiling of Wnt3a-mediated signaling network: indicating the involvement of ribonucleoside-diphosphate reductase M2 subunit phosphorylation at residue serine 20 in canonical Wnt signal transduction.
17487921 2007 Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16804917 2006 A novel fusion of the MALT1 gene and the microtubule-associated protein 4 (MAP4) gene occurs in diffuse large B-cell lymphoma.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16093351 2005 Mammalian septins regulate microtubule stability through interaction with the microtubule-binding protein MAP4.
15840946 2005 Truncation of the projection domain of MAP4 (microtubule-associated protein 4) leads to attenuation of microtubule dynamic instability.
15528234 2005 Inhibition of beta-adrenergic receptor trafficking in adult cardiocytes by MAP4 decoration of microtubules.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
14759258 2004 An unappreciated role for RNA surveillance.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14594945 2004 MARK4 is a novel microtubule-associated proteins/microtubule affinity-regulating kinase that binds to the cellular microtubule network and to centrosomes.
14527689 2003 Adenovirus 2 E1B-55K protein relieves p53-mediated transcriptional repression of the survivin and MAP4 promoters.
12890753 2003 Interphase and monoastral-mitotic phenotypes of overexpressed MAP4 are modulated by free tubulin concentrations.
12855424 2003 Phenotypic consequences of beta1-tubulin expression and MAP4 decoration of microtubules in adult cardiocytes.
12773533 2003 The number of repeat sequences in microtubule-associated protein 4 affects the microtubule surface properties.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12123579 2002 MAP4 counteracts microtubule catastrophe promotion but not tubulin-sequestering activity in intact cells.
11683421 2001 Phosphorylation of MAP4 affects microtubule properties and cell cycle progression.
10791892 2000 Ser787 in the proline-rich region of human MAP4 is a critical phosphorylation site that reduces its activity to promote tubulin polymerization.
10542369 1999 Phosphorylation of MAP2c and MAP4 by MARK kinases leads to the destabilization of microtubules in cells.
10341201 1999 Microtubule-associated protein 4 (MAP4) regulates assembly, protomer-polymer partitioning and synthesis of tubulin in cultured cells.
9398320 1997 MAP4 is the in vivo substrate for CDC2 kinase in HeLa cells: identification of an M-phase specific and a cell cycle-independent phosphorylation site in MAP4.
9365275 1997 Overexpression of MAP4 inhibits organelle motility and trafficking in vivo.
9110174 1997 Large-scale concatenation cDNA sequencing.
8631898 1996 Phosphorylation of microtubule-associated proteins MAP2 and MAP4 by the protein kinase p110mark. Phosphorylation sites and regulation of microtubule dynamics.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
7909279 1994 Cellular microtubules heterogeneous in their content of microtubule-associated protein 4 (MAP4).
7876309 1995 Cyclin B interaction with microtubule-associated protein 4 (MAP4) targets p34cdc2 kinase to microtubules and is a potential regulator of M-phase microtubule dynamics.
7857940 1995 Differential expression of alternatively spliced forms of MAP4: a repertoire of structurally different microtubule-binding domains.
1905296 1991 Non-neuronal 210 x 10(3) Mr microtubule-associated protein (MAP4) contains a domain homologous to the microtubule-binding domains of neuronal MAP2 and tau.
1718985 1991 A model for microtubule-associated protein 4 structure. Domains defined by comparisons of human, mouse, and bovine sequences.
1477887 1992 Microtubule stabilization by assembly-promoting microtubule-associated proteins: a repeat performance.