Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.83
PubTator Score 4.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
gastric cancer 1.700 9.0e-03
hepatocellular carcinoma 1.600 5.0e-05
pancreatic cancer 2.200 3.2e-03
malignant mesothelioma -1.600 1.0e-06
glioblastoma 1.300 1.9e-03
cystic fibrosis -1.694 3.2e-05
autosomal dominant Emery-Dreifuss muscul... 1.360 2.2e-02
sarcoidosis 1.300 4.8e-02
interstitial cystitis 2.100 8.8e-05
adult high grade glioma 1.500 9.9e-05
pilocytic astrocytoma 2.100 1.3e-06
pancreatic carcinoma 2.200 3.2e-03
lung carcinoma 1.300 1.4e-30
head and neck cancer -1.500 2.9e-02

Synonym

Accession P57077 D3DSE0 Q8TCL9
Symbols TAKL
TAK1L
TAKL-1
TAKL-2
TAKL-4
C21orf7
HC21ORF7

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MVQLIAPLEVMWNEAADLKPLALSRRLECSGGIMAHYSPDLLGPEMESRYFAQVGLEHLASSSPPAFGFL      1 - 70
KCLDYSISVLCSATSLAMLEDNPKVSKLATGDWMLTLKPKSITVPVEIPSSPLDDTPPEDSIPLVFPELD     71 - 140
QQLQPLPPCHDSEESMEVFKQHCQIAEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDAAELVREFEAL    141 - 210
TEENRTLRLAQSQCVEQLEKLRIQYQKRQGSS                                          211 - 242
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23259602 2012 Genome-wide association scan of dental caries in the permanent dentition.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16780588 2006 Cell array-based intracellular localization screening reveals novel functional features of human chromosome 21 proteins.
16381901 2006 The LIFEdb database in 2006.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15168726 2004 Cloning and characterization of a novel human TGF-beta activated kinase-like gene.
14759258 2004 An unappreciated role for RNA surveillance.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11707072 2001 From PREDs and open reading frames to cDNA isolation: revisiting the human chromosome 21 transcription map.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10830953 2000 The DNA sequence of human chromosome 21.