Property Summary

NCBI Gene PubMed Count 201
PubMed Score 27.97
PubTator Score 268.41

Knowledge Summary

Patent (24,014)

Expression

  Differential Expression (12)

Disease log2 FC p
psoriasis -1.300 6.6e-04
osteosarcoma 1.560 2.5e-04
group 4 medulloblastoma 1.300 7.3e-04
glioblastoma 1.100 2.8e-02
atypical teratoid / rhabdoid tumor 1.300 4.1e-05
juvenile dermatomyositis 1.171 1.7e-07
acute quadriplegic myopathy 1.148 2.9e-06
primary pancreatic ductal adenocarcinoma 1.098 6.2e-03
lung cancer 1.100 2.7e-03
lung adenocarcinoma 1.005 1.3e-04
ovarian cancer 2.500 2.8e-05
dermatomyositis 1.300 1.1e-03

Protein-protein Interaction (4)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (139)

PMID Text
27048361 This paper highlights that targeting the BMP and TGFbeta type I and type II receptors causes a downregulation of XIAP, TAK1, and Id1 leading to cell death of lung cancer cells.
26823762 TAK1 may be an important factor involved in the pathogenesis of thyroid cancer, and targeted down-regulation of TAK1 may improve the prognosis of patients with thyroid cancer.
26491199 The data emphasize the central role of TAK1 in controlling signaling cascades and functional responses in primary neutrophils, making it a promising target for therapeutic intervention in view of the role of neutrophils in chronic inflammatory conditions.
26468522 HIV-1 (NL43) Vpr S79A mutant, which no longer binds TAK1, demonstrates impaired ability to trigger TNF-alpha secretion from MT4C5 cells suggesting TAK1/Vpr interaction enhances TNF secretion from HIV-1 infected cells
26406417 Loss of MAP3K7 are associated with esophageal squamous cell carcinoma.
26401039 HIV-1 (NL43) Vpr S79A mutant, which no longer binds TAK1, demonstrates impaired ability to trigger TNF-alpha secretion from MT4C5 cells suggesting TAK1/Vpr interaction enhances TNF secretion from HIV-1 infected cells
26189595 Polyubiquitination of Transforming Growth Factor beta-activated Kinase 1 (TAK1) at Lysine 562 Residue Regulates TLR4-mediated JNK and p38 MAPK Activation
26185333 the TAK1 signaling pathway may represent a suitable target to design new, antifibrotic therapies
25889255 MiR-377 is an important negative regulator of E2F and MAP3K7/NF-kB signaling pathway in melanoma cells.
25770290 identify coordinate loss of MAP3K7 and CHD1 as a unique driver of aggressive prostate cancer development
25557171 Data indicate that inhibition of TGF-beta-activated protein kinase 1 (TAK1) reduces chemokine (C-C motif) receptor 7 (CCR7) expression.
25383712 Findings indicate that SHIP2 is a regulator of lymphatic function in humans and that inherited mutations in the INPPL1 gene may act in concert with HGF, and likely MAP3K7, mutations to exacerbate lymphatic phenotypes.
25371197 Data show that the ECSIT (evolutionarily conserved signaling intermediate in Toll pathways) complex, including MEKK7 (TAK1) and TNF receptor-associated factor 6 (TRAF6), plays a role in Toll-like receptor 4 -mediated signals to activate NF-kappa B.
25288801 Data suggest a role for the mitogen-activated protein kinase kinase kinase 7 TAK1-jun-NH2-Terminal Kinase JNK pathway as a critical regulator of NLRP3 protein inflammasome activation.
25261726 TAK1 may be an important oncogene or an effective target for renal cell carcinoma intervention.
25189770 Ubc13 was dispensable for transforming growth factor beta (TGFbeta)-induced SMAD activation but was required for activation of non-SMAD signaling via TGFbeta-activating kinase 1 (TAK1) and p38
25075558 Data indicate 4-substituted 1H-pyrrolo[2,3-b]pyridines as potent inhibitors against TGFbeta-activated kinase 1 (TAK1) and mitogen-activated protein kinase kinase kinase kinase 2 (MAP4K2).
24912525 HIV-1 (NL43) Vpr S79A mutant, which no longer binds TAK1, demonstrates impaired ability to trigger TNF-alpha secretion from MT4C5 cells suggesting TAK1/Vpr interaction enhances TNF secretion from HIV-1 infected cells
24911653 Data suggest TAK1 and IKKbeta (inhibitor of kappaB kinase beta) phosphorylate different serines of IKKbeta; TAK1-catalyzed phosphorylation of IKKbeta at Ser177 is priming event that enables IKKbeta to activate itself by phosphorylating Ser181.
24874739 Nef markedly activated TAK1 in M-CSF-derived M2-MPhi but not in GM-CSF-derived M1-MPhi.
24874739 HIV-1 (NL43) Vpr S79A mutant, which no longer binds TAK1, demonstrates impaired ability to trigger TNF-alpha secretion from MT4C5 cells suggesting TAK1/Vpr interaction enhances TNF secretion from HIV-1 infected cells
24721172 NLK functions as a pivotal negative regulator of NF-kappaB via disrupting the interaction of TAK1 with IKKbeta.
24443058 TAK1 plays a role in tumor initiation, progression, and metastasis as a tumor prompter or tumor suppressor. An understanding of the role of TAK1 in liver physiology and diseases is required for the development of therapeutic agencies targeting TAK1
24277938 Data indicate that ribosomal S6 kinase 1 (S6K1) is negatively involved in the toll-like receptorS TLR2 and TLR4 signaling pathway by the inhibition of TAK1 (MAP3K7) activity.
24113182 A dysregulated balance in the activation of TGFbeta-TAK1 and TGFbeta-SMAD pathways is pivotal for TGFbeta1-induced epithelial-mesenchymal transition.
24072697 Results establish TAK1 as an AMPKalpha1 kinase that regulates vascular endothelial growth factor-induced and cytokine-induced angiogenesis by modulating SOD2 expression and the superoxide anion:hydrogen peroxide balance.
23760366 TAK1 (MAP3K7) does not mediate the TGFb-induced phosphorylation of p38 mitogen-activated protein kinases.
23705972 HIV-1 (NL43) Vpr S79A mutant, which no longer binds TAK1, demonstrates impaired ability to trigger TNF-alpha secretion from MT4C5 cells suggesting TAK1/Vpr interaction enhances TNF secretion from HIV-1 infected cells
23534745 Overexpression of TAK1 predicts a poor prognosis in patients with clear cell renal cell carcinoma, so that TAK1 may serve as a novel prognostic marker
23472066 14-3-3epsilon associates with TAK1 in a phosphorylation-dependent manner to determine the cell fate of Bleomycin-treated HCC cells
23370768 our study identifies MAP3K7 deletion as a prominent feature in ERG-negative prostate cancer
23272845 TAK1 expression correlates with lymph node metastasis and is a negative, independent prognostic factor in resected T3N1-3M0 ESCCs.
23229544 findings suggest that DUSP14 negatively regulates TNF- or IL-1-induced NF-kappaB activation by dephosphorylating TAK1 at Thr-187
23087682 HIV-1 (NL43) Vpr S79A mutant, which no longer binds TAK1, demonstrates impaired ability to trigger TNF-alpha secretion from MT4C5 cells suggesting TAK1/Vpr interaction enhances TNF secretion from HIV-1 infected cells
23077317 HIV-1 (NL43) Vpr S79A mutant, which no longer binds TAK1, demonstrates impaired ability to trigger TNF-alpha secretion from MT4C5 cells suggesting TAK1/Vpr interaction enhances TNF secretion from HIV-1 infected cells
22972987 We found that endothelial TAK1 and TAB2, but not TAB1, were critically involved in vascular formation
22941947 TAK1 plays central role in both innate and adaptive immunity as well as in DNA damage, osmotic stress, and hypoxia. (Review)
22843747 Results indicate that TAK1 and p38 kinases appear to be central in the 'priming effect' of LTB(4) on neutrophils to enhance response to Toll-like receptor ligands.
22835455 review focuses on current insights into the mechanism and function of the Smad-independent signaling pathway via TGF-beta-activated kinase 1 and its role in mediating the profibrotic effects of TGF-beta1 in chronic kidney disease. [Review Article]
22802624 evidence that TAK1 is a target for YopJ-mediated inhibition.
22649101 The phosphorylated form of TAK1 is abundantly expressed in a panel of lymphoma cell lines, including mantle cell, anaplastic large cell, and Hodgkin lymphoma. siRNA inhibited the activation of NF-kappaB and p38 and induced apoptosis in lymphoma cell lines.
22590573 Kaposi's sarcoma associated herpesvirus encoded viral FLICE inhibitory protein K13 activates NF-kappaB pathway independent of TRAF6, TAK1 and LUBAC
22576335 Two SNPs, rs282070 located in intron 1 of the MAP3K7 gene, and rs2111699 located in intron 1 of the GSTZ1 gene, were significantly associated (after adjustment for multiple testing) with longevity in stage 2
22490020 the role of TAK1 in cell death, cell cycle regulation and apoptosis after X irradiation is independent of NF-kappaB, p38 MAPK, and ERK phosphorylation, and dependent, in part, on p21 induction
22467172 In the grafts containing Tak1-suppressed prostate stem cells, p38 and c-jun-NH(2)-kinase activity was attenuated and proliferation was increased
22384029 Inhibition of transforming growth factor-activated kinase 1 (TAK1) blocks and reverses epithelial to mesenchymal transition of mesothelial cells
22341466 TAK1 activity was required for HIV-1 gp41 cytoplasmic domain-mediated NF-kappaB activation, and HIV-1-derived gp41 cytoplasmic domain physically interacted with TAK1 through the same region required for NF-kappaB activation.
22341466 HIV-1 (NL43) Vpr S79A mutant, which no longer binds TAK1, demonstrates impaired ability to trigger TNF-alpha secretion from MT4C5 cells suggesting TAK1/Vpr interaction enhances TNF secretion from HIV-1 infected cells
22341439 Data suggest that TAK1 functions as a prosurvival mediator in cancer cells displaying hyperactive KRAS-dependent Wnt signaling.
22256769 Study on effect of fushenkeli on expression of TAK1 in human renal tubular epithelial cells and its possible mechanism
22167179 TAK1 and its adapter protein, TAB2, reciprocally regulate both TAK1- and ASK1-mediated signaling pathways to direct the activations of NF-kappaB and AP-1.
22069318 polyubiquitination of TAK1 is correlated with activation of TAK1 and is essential for activation of NF-kappaB signaling downstream of several receptors
21873447 TAK1 plays a major role in growth factor-induced phenotypic modulation of airway smooth muscle remodeling.
21866272 HIV-1 (NL43) Vpr S79A mutant, which no longer binds TAK1, demonstrates impaired ability to trigger TNF-alpha secretion from MT4C5 cells suggesting TAK1/Vpr interaction enhances TNF secretion from HIV-1 infected cells
21743023 Results that genetic silencing or inhibition of TAK1 kinase activity in vivo is a potential therapeutic approach to reversal of the intrinsic chemoresistance of pancreatic cancer.
21700681 these studies show that the TAK1-TAB2-TAB3 signaling axis is critical for carcinoma-induced bone lesions, mediating expression of proinvasive and osteolytic factors.
21606198 Data show that DNA damage stimulates the formation of a cytosolic complex of ATM, NEMO, RIP1, and TAK1, and that TAK1 mediates the NF-kappaB and p38 mitogen-activated protein kinase (MAPK)/MAPK-activated protein 2 responses to DNA damage.
21575904 HIV-1 (NL43) Vpr S79A mutant, which no longer binds TAK1, demonstrates impaired ability to trigger TNF-alpha secretion from MT4C5 cells suggesting TAK1/Vpr interaction enhances TNF secretion from HIV-1 infected cells
21572451 HIV-1 (NL43) Vpr S79A mutant, which no longer binds TAK1, demonstrates impaired ability to trigger TNF-alpha secretion from MT4C5 cells suggesting TAK1/Vpr interaction enhances TNF secretion from HIV-1 infected cells
21512573 HIV-1 (NL43) Vpr S79A mutant, which no longer binds TAK1, demonstrates impaired ability to trigger TNF-alpha secretion from MT4C5 cells suggesting TAK1/Vpr interaction enhances TNF secretion from HIV-1 infected cells
21512569 HIV-1 (NL43) Vpr S79A mutant, which no longer binds TAK1, demonstrates impaired ability to trigger TNF-alpha secretion from MT4C5 cells suggesting TAK1/Vpr interaction enhances TNF secretion from HIV-1 infected cells
21498517 TAK1-c-Rel and IRF4 pathways play distinct roles in the maintenance of IL-9-producing Th17 phenotype of HTLV-1-transformed cells
21233843 The TAK1 regulated inhibition of TNF-alpha-mediated apoptosis via the autocrine action of stem cell factor.
21220427 LPS-induced activation of IRAK4 and TAK1, K63-linked polyubiquitination of IRAK1 and TRAF6, and disrupted IRAK1-TRAF6 and IRAK1-IKKgamma assembly associated with increased A20 expression
21098640 p38 maintains E-cadherin expression by suppressing TAK1-NF-kappaB signaling, thus impeding the induction of epithelial-to-mesenchymal transition in human primary mesothelial cells.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20932476 ATM- and NEMO-dependent ubiquitination of ELKS leads to the ubiquitin-dependent assembly of TAK1/TAB2/3 and NEMO/IKK complexes, resulting in IKK and NF-kappaB activation following genotoxic stimuli.
20837137 TAK1 lysine 158, but not lysine 34, is required for TGF-beta-induced TAK1 polyubiquitination and TGF-beta-induced TRAF6-mediated Smad-independent IKK, JNK and p38 activation.
20682854 The systemic TAK1 gene silencing decreases the frequency of Th1 and Th17 cells, both mediating autoimmunity in experimental arthritis, demonstrating the immunomodulatory potential of TAK1.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20585109 A20 improves cardiac functions and inhibits cardiac hypertrophy, inflammation, apoptosis, and fibrosis by blocking transforming growth factor-beta-activated kinase 1-dependent signaling.
20538596 Co-expression of TAK1 and TAB1 resulted in a functional and active TAK1-TAB1 complex capable of directly activating full-length heterotrimeric mammalian AMP-activated protein kinase (AMPK) in vitro.
20448286 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20306291 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20061393 findings provide the first evidence that TAK1-NLK pathway is a novel regulator of FOXO1
20038579 Lys(63)-linked polyubiquitination of TAK1 at Lys(158) is essential for its own kinase activation and its ability to mediate its downstream signal transduction pathways in response to TNFalpha and IL-1beta stimulation.
19820695 polyubiquitination of TAK1 regulates the activation of NF-kappaB, which in turn is used by H. pylori CagA for the H. pylori-induced inflammatory response
19760754 Observational study of gene-disease association. (HuGE Navigator)
19687304 These results demonstrated that TAK1 controls two different signaling pathways, IkappaB kinase-NF-kappaB and MAPK-EGFR, leading to the survival of cells exposed to the death signal from the TNF-alpha receptor.
19675569 results indicate that unanchored polyubiquitin chains directly activate TAK1 and IKK, suggesting a new mechanism of protein kinase regulation
19578758 periostin is involved in the suppression of cell invasiveness via the TAB1/TAK1 signaling pathway.
19419968 novel homeostatic control of keratinocyte proliferation and migration mediated via TAK1 regulation of von Hippel-Lindau tumor suppressor
19410630 TNFalpha and its downstream TAK1, which are key mediators for NF-kappaB and MAPK pathways, may be involved in the pathogenesis of endometriosis.
19284290 Data indicate that TAK1-D plays a role in the signaling events triggered by selected types of ribotoxic stress.
19232515 These results suggest that FBXW5 negatively regulates TAK1 in the IL-1beta signaling pathway.
19197243 TRAIL-induced AMPK activation depends on transforming growth factor-beta-activating kinase 1 (TAK1) and TAK1-binding subunit 2.
19074436 the presence of melittin, TRAIL-induced apoptosis is significantly increased in TRAIL-resistant HCC cells, which may be attributed to melittin-induced TAK1-JNK/p38 activation and melittin-mediated inhibition of IkappaBalpha kinase-NFkappaB.
19047046 as a mediator of SF- and Src-stimulated NF-kappaB activity. Finally, the Src/Rac1/MKK3/6/p38 and Src/TAK1/NF-kappaB-inducing kinase pathways exhibited cross-talk at the level of MKK3.
19026643 These results suggest that Hsp90 is required for the folding and stability of TAK1 but is displaced and no longer required when TAK1 is complexed to TAK1-binding protein-1.
18976975 Knockdown of mitogen-activated protein kinase kinase kinase 7 (MAP3K7) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18950863 Hsp90 regulates IL-1beta-induced signaling by interacting with TAK1 and maintaining the stability of TAK1, suggesting that Hsp90 might act as the chaperone of TAK1 in immune and inflammatory responses related with IL-1 signal cascades.
18758450 TGF-beta specifically activates TAK1 through interaction of TbetaRI with TRAF6, whereas activation of Smad2 is not dependent on TRAF6.
18617512 Phosphorylation of Thr-178 and Thr-184 in the TAK1 T-loop is required for interleukin (IL)-1-mediated optimal NFkappaB and AP-1 activation as well as IL-6 gene expression.
18456659 TAB4 binds TAK1 and polyubiquitin chains to promote specific sites of phosphorylation in TAK1-TAB1, which activates IKK signaling to NF-kappaB.
18326498 suggest that Pellino 3b acts as a negative regulator for IL-1 signaling by regulating IRAK degradation through its ubiquitin protein ligase activity
18316610 a TAB1:TAK1:IKK beta:NF-kappaB signaling axis forms aberrantly in breast cancer cells and, consequently, enables oncogenic signaling by TGF-beta
18299321 PP2A functions as a negative regulator in TGF-beta1-induced TAK1 activation
18206350 Data provide insights into the homeostatic interactions that maintain basal NF-kappaB levels by holding the enzymes MEKK3 and TAK1 in their inactive state.
17982039 two independent and indispensable signaling pathways-1) JAK1-associated PI3K signaling and 2) Act1/TRAF6/TAK1-mediated NF-kappaB activation-are stimulated by IL-17A to regulate gene induction in human airway epithelial cells.
17947700 These signals exert their anti-inflammatory effects by inhibiting phosphorylation of TAK1
17828308 TAK1 contributes to TGF-beta1-mediated tumor angiogenesis and metastasis via involvement of the TAK1-NF-kappaB-MMP-9 pathway.
17626013 p38 negatively regulated TAK1 activity through TAB1 phosphorylation.
17608743 BY acting at the level of TAK1 (MAP3K7) activation, YopJ inhibited TLR-mediated NF-kappaB and MAP kinase activation as well as IRF3 signalling.
17559674 TAK1 as a pivotal upstream kinase and potential therapeutic target to modulate synoviocyte activation in RA.
17379600 IHPK2-TRAF2 binding leads to attenuation of TAK1- and NF-kappaB-mediated signaling and is partially responsible for the apoptotic activity of IHPK2.
17363973 Study shows that Tax functions as an intracellular stimulator of an IKK-activating kinase, Tak1; in addition, Tax physically interacts with Tak1 and mediates the recruitment of IKK to Tak1.
17325661 TAK1 is thought to play a causative role in the determination of a finite replicative lifespan of normal and cancer cells
17276978 Modulates TGF-beta-dependent cellular responses by targeting SnoN/SKIL for degradation, thereby allowing the activation of TGF-beta target genes.
17202147 HSP27 is required for both IL-1 and TNF-induced signaling pathways for which the most upstream common signaling protein is TAK1.
17173073 HspB8 overload causes melanoma growth arrest and apoptosis through TAK1 activation
17158449 The TAB2/TAB3 interaction with TAK1 is crucial for the activation of signaling cascades mediated by interleukin-1, tumor necrosis factor, and receptor activator of nuclear factor-kappa B ligand (RANKL).
17114179 the nuclear factor-kappaB signaling pathway is inhibed by gamma-tocopherol through inhibition of receptor-interacting protein and TAK1 leading to suppression of antiapoptotic gene products and potentiation of apoptosis
16893890 the TAK1-JNK pathway is activated by osmotic stress, while blocking TAK1-mediated NF-kappaB activation; TAO2 regulates TAK1 pathways
16835226 TAK1 is a functional member of the Snf1/AMPK kinase family
16527194 A candidate gene in ectodermal dysplasia.
16446357 an LMP1-associated complex containing TRAF6, TAB2, and TAK1 plays an essential role in the activation of JNK
16293250 TAK1 plays a critical role in T cell activation by controlling production of IL-2.
16280329 LMP1 utilizes two distinct pathways to activate NF-kappaB: a major one through CTAR2/TRAF6/TAK1/IKKbeta (canonical pathway) and a minor one through CTAR1/TRAF3/NIK/IKKalpha (noncanonical pathway)
16260783 TAK1 is recruited to the TNF-R1 complex via RIP and likely cooperates with MEKK3 to activate NF-kappaB in TNF-alpha signaling
16251197 Involvement of the TAB2/TRAF6/TAK1 signalling complex in the Edar signal transduction pathway has important implications for understanding of NF-kappaB activation and anhidrotic ectodermal dysplasia in human.
16000313 Arachidonic acid-mediated TAK1 activation is responsible for MAP kinase kinase 6 activation and the ensuing downstream signaling in metastatic human breast carcinoma cells
15917296 interleukin-1beta and its downstream mediator TAK1 inhibit mothers against decapentaplegic homolog 3 MAD-mediated TGFbeta target gene activation
15764709 STAT3 enhances the efficiency of its own Ser-727 phosphorylation by acting as a scaffold for the TAK1-NLK kinases
15670770 Experiments using dominant-negative Tpl2 suggest this kinase functions distal to TRAFs but proximal to the TAK1/TAB1 signaling complex, within the IKK/NFkappaB activation pathway.
15590691 characterized the molecular mechanisms of cellular stress-induced TAK1 activation, focusing mainly on the phosphorylation of TAK1 at Thr-187 and Ser-192 in the activation loop; TAB1 and TAB2 were differentially involved in the phosphorylation of TAK1
15277532 TAK1 binds with Sef, which has a role in JNK activation and apoptosis
15125833 TAK1 protein kinase mediate IKK activation by BCL10 and MALT1. RNAi-mediated silencing of TAK1 suppressed TCR-dependent IKK activation and interleukin-2 production in T cells
14960582 Tak1 has a role in Wnt signal transduction and phosphorylation and inhibition of TCF
14592977 TAB1 participates in a SAPK2a/p38alpha-mediated feedback control of TAK1
12859960 Results indicate that dominant negative constructs of TAK1 retain the ability to intercept the TGF-beta signaling effectively.
12842894 TAK1 has a role in TNF-alpha induced IKK phosphorylation of NF-kappaB p65
12804775 Pellino2 interacts with TAK1 and activates the MAP kinase pathway.
12589052 TAK1- and MKK3-mediated activation of p38 are facilitated by Smad7
12547194 TNFalpha activation of the NF-kappaB pathway is associated with the inducible binding of TAK1 to TRAF2 and both IKKalpha and IKKbeta
12372426 The TAK1-TAB1 fusion protein is a novel constitutively active mitogen-activated protein kinase kinase kinase that stimulates AP-1 and NF-kappaB signaling pathways
12296995 TAK1-dependent activation of AP-1 and c-Jun N-terminal kinase by receptor activator of NF-kappaB.
12242293 Interleukin-1 (IL-1) receptor-associated kinase-dependent IL-1-induced signaling complexes phosphorylate TAK1 and TAB2 at the plasma membrane and activate TAK1 in the cytosol.
2648522 HIV-1 (NL43) Vpr S79A mutant, which no longer binds TAK1, demonstrates impaired ability to trigger TNF-alpha secretion from MT4C5 cells suggesting TAK1/Vpr interaction enhances TNF secretion from HIV-1 infected cells

AA Sequence

MSTASAASSSSSSSAGEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESE      1 - 70
RKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQG     71 - 140
VAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDIQTHMTNNKGSAAWMAPEVFEGSNYSEKC    141 - 210
DVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEI    211 - 280
VKIMTHLMRYFPGADEPLQYPCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLES    281 - 350
KLLKNQAKQQSESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIAATTAYSKPKRGHRKTASFGN    351 - 420
ILDVPEIVISGNGQPRRRSIQDLTVTGTEPGQVSSRSSSPSVRMITTSGPTSEKPTRSHPWTPDDSTDTN    421 - 490
GSDNSIPMAYLTLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEIALLLQRKQELVAELDQDEKD    491 - 560
QQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQKRQGTS                            561 - 606
//

Text Mined References (219)

PMID Year Title
27426733 2016 Mutations in MAP3K7 that Alter the Activity of the TAK1 Signaling Complex Cause Frontometaphyseal Dysplasia.
27048361 2016 Inhibition of BMP and of TGF? receptors downregulates expression of XIAP and TAK1 leading to lung cancer cell death.
26823762 2015 The role of TAK1 expression in thyroid cancer.
26491199 2015 Activation of TAK1 by Chemotactic and Growth Factors, and Its Impact on Human Neutrophil Signaling and Functional Responses.
26406417 2015 Identification of genomic biomarkers associated with the clinicopathological parameters and prognosis of esophageal squamous cell carcinoma.
26189595 2015 Polyubiquitination of Transforming Growth Factor ?-activated Kinase 1 (TAK1) at Lysine 562 Residue Regulates TLR4-mediated JNK and p38 MAPK Activation.
26185333 2015 TAK1 is a key modulator of the profibrogenic phenotype of human ileal myofibroblasts in Crohn's disease.
25889255 2015 MiR-377 targets E2F3 and alters the NF-kB signaling pathway through MAP3K7 in malignant melanoma.
25770290 2015 Coordinate loss of MAP3K7 and CHD1 promotes aggressive prostate cancer.
25557171 2015 Targeting of TGF-?-activated protein kinase 1 inhibits chemokine (C-C motif) receptor 7 expression, tumor growth and metastasis in breast cancer.
25383712 2014 Evidence for SH2 domain-containing 5'-inositol phosphatase-2 (SHIP2) contributing to a lymphatic dysfunction.
25371197 2014 TAK1-ECSIT-TRAF6 complex plays a key role in the TLR4 signal to activate NF-?B.
25288801 2014 The lysosome rupture-activated TAK1-JNK pathway regulates NLRP3 inflammasome activation.
25261726 2014 Identification of TGF-?-activated kinase 1 as a possible novel target for renal cell carcinoma intervention.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25189770 2014 Ubiquitin-conjugating enzyme Ubc13 controls breast cancer metastasis through a TAK1-p38 MAP kinase cascade.
25075558 2015 Discovery of type II inhibitors of TGF?-activated kinase 1 (TAK1) and mitogen-activated protein kinase kinase kinase kinase 2 (MAP4K2).
24911653 2014 An unexpected twist to the activation of IKK?: TAK1 primes IKK? for activation by autophosphorylation.
24874739 2014 Macropinocytosis and TAK1 mediate anti-inflammatory to pro-inflammatory macrophage differentiation by HIV-1 Nef.
24792382 2014 Genome-wide association study identifies ALLC polymorphisms correlated with FEV? change by corticosteroid.
24721172 2014 Nemo-like kinase (NLK) negatively regulates NF-kappa B activity through disrupting the interaction of TAK1 with IKK?.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24443058 2014 TAK1 regulates hepatic cell survival and carcinogenesis.
24277938 2014 S6K1 negatively regulates TAK1 activity in the toll-like receptor signaling pathway.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24113182 2013 Loss of TAK1 increases cell traction force in a ROS-dependent manner to drive epithelial-mesenchymal transition of cancer cells.
24072697 2013 Transforming growth factor-?-activated kinase 1 regulates angiogenesis via AMP-activated protein kinase-?1 and redox balance in endothelial cells.
23776175 2013 SASH1 is a scaffold molecule in endothelial TLR4 signaling.
23760366 2013 The TGF?-induced phosphorylation and activation of p38 mitogen-activated protein kinase is mediated by MAP3K4 and MAP3K10 but not TAK1.
23534745 2013 TGF-?-activated kinase-1: a potential prognostic marker for clear cell renal cell carcinoma.
23472066 2013 14-3-3? mediates the cell fate decision-making pathways in response of hepatocellular carcinoma to Bleomycin-induced DNA damage.
23370768 2013 Genomic deletion of MAP3K7 at 6q12-22 is associated with early PSA recurrence in prostate cancer and absence of TMPRSS2:ERG fusions.
23272845 2013 Positive transforming growth factor-? activated kinase-1 expression has an unfavorable impact on survival in T3N1-3M0 esophageal squamous cell carcinomas.
23229544 2013 The dual-specificity phosphatase DUSP14 negatively regulates tumor necrosis factor- and interleukin-1-induced nuclear factor-?B activation by dephosphorylating the protein kinase TAK1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22972987 2012 TAK1 kinase signaling regulates embryonic angiogenesis by modulating endothelial cell survival and migration.
22941947 2012 TAK1, more than just innate immunity.
22843747 2012 TAK1 contributes to the enhanced responsiveness of LTB(4)-treated neutrophils to Toll-like receptor ligands.
22835455 2012 TGF-? signaling via TAK1 pathway: role in kidney fibrosis.
22802624 2012 Serine/threonine acetylation of TGF?-activated kinase (TAK1) by Yersinia pestis YopJ inhibits innate immune signaling.
22649101 2012 Essential role of TAK1 in regulating mantle cell lymphoma survival.
22590573 2012 Kaposi's sarcoma associated herpesvirus encoded viral FLICE inhibitory protein K13 activates NF-?B pathway independent of TRAF6, TAK1 and LUBAC.
22576335 2013 MAP3K7 and GSTZ1 are associated with human longevity: a two-stage case-control study using a multilocus genotyping.
22490020 2012 TGF-?-activated kinase 1 promotes cell cycle arrest and cell survival of X-ray irradiated HeLa cells dependent on p21 induction but independent of NF-?B, p38 MAPK and ERK phosphorylations.
22467172 2012 Suppression of Tak1 promotes prostate tumorigenesis.
22406003 2012 Lys48-linked TAK1 polyubiquitination at lysine-72 downregulates TNF?-induced NF-?B activation via mediating TAK1 degradation.
22384029 2012 Inhibition of transforming growth factor-activated kinase 1 (TAK1) blocks and reverses epithelial to mesenchymal transition of mesothelial cells.
22341466 2012 The cytoplasmic domain of the HIV-1 glycoprotein gp41 induces NF-?B activation through TGF-?-activated kinase 1.
22341439 2012 TAK1 inhibition promotes apoptosis in KRAS-dependent colon cancers.
22256769 2011 [Study on effect of fushenkeli on expression of TAK1 in human renal tubular epithelial cells and its possible mechanism].
22167179 2012 Reciprocal inhibition between the transforming growth factor-?-activated kinase 1 (TAK1) and apoptosis signal-regulating kinase 1 (ASK1) mitogen-activated protein kinase kinase kinases and its suppression by TAK1-binding protein 2 (TAB2), an adapter protein for TAK1.
22081109 2011 Inhibition of autophagy by TAB2 and TAB3.
22069318 2012 Polyubiquitination of transforming growth factor ? (TGF?)-associated kinase 1 mediates nuclear factor-?B activation in response to different inflammatory stimuli.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21873447 2011 TAK1 plays a major role in growth factor-induced phenotypic modulation of airway smooth muscle.
21841780 2011 A genome-wide association study identifies two new risk loci for Graves' disease.
21743023 2011 Modulation of pancreatic cancer chemoresistance by inhibition of TAK1.
21700681 2011 TAK1-TAB2 signaling contributes to bone destruction by breast carcinoma cells.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21606198 2011 A cytosolic ATM/NEMO/RIP1 complex recruits TAK1 to mediate the NF-kappaB and p38 mitogen-activated protein kinase (MAPK)/MAPK-activated protein 2 responses to DNA damage.
21512573 2011 TRIM5 is an innate immune sensor for the retrovirus capsid lattice.
21498517 2011 Distinct roles of transforming growth factor-beta-activated kinase 1 (TAK1)-c-Rel and interferon regulatory factor 4 (IRF4) pathways in human T cell lymphotropic virus 1-transformed T helper 17 cells producing interleukin-9.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21233843 2011 TAK1 regulates SCF expression to modulate PKB? activity that protects keratinocytes from ROS-induced apoptosis.
21220427 2011 Endotoxin tolerance impairs IL-1 receptor-associated kinase (IRAK) 4 and TGF-beta-activated kinase 1 activation, K63-linked polyubiquitination and assembly of IRAK1, TNF receptor-associated factor 6, and IkappaB kinase gamma and increases A20 expression.
21098640 2010 p38 maintains E-cadherin expression by modulating TAK1-NF-kappa B during epithelial-to-mesenchymal transition.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20932476 2010 ATM- and NEMO-dependent ELKS ubiquitination coordinates TAK1-mediated IKK activation in response to genotoxic stress.
20837137 2011 TAK1 lysine 158 is required for TGF-?-induced TRAF6-mediated Smad-independent IKK/NF-?B and JNK/AP-1 activation.
20682854 2010 In vivo RNAi-mediated silencing of TAK1 decreases inflammatory Th1 and Th17 cells through targeting of myeloid cells.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20585109 2010 Tumor suppressor A20 protects against cardiac hypertrophy and fibrosis by blocking transforming growth factor-beta-activated kinase 1-dependent signaling.
20538596 2010 Autoactivation of transforming growth factor beta-activated kinase 1 is a sequential bimolecular process.
20448286 2010 Association between anti-tumour necrosis factor treatment response and genetic variants within the TLR and NF{kappa}B signalling pathways.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20306291 2010 A three-stage genome-wide association study of general cognitive ability: hunting the small effects.
20190752 2010 Multiple common variants for celiac disease influencing immune gene expression.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20061393 2010 Regulation of FOXO1 by TAK1-Nemo-like kinase pathway.
20060931 2010 The TAK1-TRAF6 signalling pathway.
20038579 2010 Lysine 63-linked polyubiquitination of TAK1 at lysine 158 is required for tumor necrosis factor alpha- and interleukin-1beta-induced IKK/NF-kappaB and JNK/AP-1 activation.
19820695 2009 Helicobacter pylori CagA activates NF-kappaB by targeting TAK1 for TRAF6-mediated Lys 63 ubiquitination.
19760754 2010 Analysis of 39 Crohn's disease risk loci in Swedish inflammatory bowel disease patients.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19687304 2009 TAK1-mediated serine/threonine phosphorylation of epidermal growth factor receptor via p38/extracellular signal-regulated kinase: NF-{kappa}B-independent survival pathways in tumor necrosis factor alpha signaling.
19675569 2009 Direct activation of protein kinases by unanchored polyubiquitin chains.
19578758 2009 Suppression of cell invasiveness by periostin via TAB1/TAK1.
19521662 2009 WDR34 is a novel TAK1-associated suppressor of the IL-1R/TLR3/TLR4-induced NF-kappaB activation pathway.
19419968 2009 Regulation of cell proliferation and migration by TAK1 via transcriptional control of von Hippel-Lindau tumor suppressor.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19410630 2009 TAK1 activation for cytokine synthesis and proliferation of endometriotic cells.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19284290 Short double-stranded RNAs of specific sequence activate ribosomal TAK1-D and induce a global inhibition of translation.
19232515 2009 An F-box protein, FBXW5, negatively regulates TAK1 MAP3K in the IL-1beta signaling pathway.
19197243 2009 TAK1 activates AMPK-dependent cytoprotective autophagy in TRAIL-treated epithelial cells.
19074436 2009 Melittin, a major component of bee venom, sensitizes human hepatocellular carcinoma cells to tumor necrosis factor-related apoptosis-inducing ligand (TRAIL)-induced apoptosis by activating CaMKII-TAK1-JNK/p38 and inhibiting IkappaBalpha kinase-NFkappaB.
19047046 2009 Role of Src signal transduction pathways in scatter factor-mediated cellular protection.
19026643 2008 HSP90 is required for TAK1 stability but not for its activation in the pro-inflammatory signaling pathway.
18950863 2009 Heat shock protein 90 (Hsp90) regulates the stability of transforming growth factor beta-activated kinase 1 (TAK1) in interleukin-1beta-induced cell signaling.
18838386 2008 Human ATAC Is a GCN5/PCAF-containing acetylase complex with a novel NC2-like histone fold module that interacts with the TATA-binding protein.
18758450 2008 The type I TGF-beta receptor engages TRAF6 to activate TAK1 in a receptor kinase-independent manner.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18617512 2008 Phosphorylation of Thr-178 and Thr-184 in the TAK1 T-loop is required for interleukin (IL)-1-mediated optimal NFkappaB and AP-1 activation as well as IL-6 gene expression.
18591963 2008 GIDE is a mitochondrial E3 ubiquitin ligase that induces apoptosis and slows growth.
18456659 2008 TAB4 stimulates TAK1-TAB1 phosphorylation and binds polyubiquitin to direct signaling to NF-kappaB.
18326498 2008 Pellino 3b negatively regulates interleukin-1-induced TAK1-dependent NF kappaB activation.
18316610 2008 Altered TAB1:I kappaB kinase interaction promotes transforming growth factor beta-mediated nuclear factor-kappaB activation during breast cancer progression.
18299321 2008 Protein phosphatase 2A is a negative regulator of transforming growth factor-beta1-induced TAK1 activation in mesangial cells.
18286207 2008 Modulation of interleukin-1 transcriptional response by the interaction between VRK2 and the JIP1 scaffold protein.
18206350 2008 Homeostatic interactions between MEKK3 and TAK1 involved in NF-kappaB signaling.
18088087 2008 Phosphoproteome of resting human platelets.
17982039 2007 Requirement for both JAK-mediated PI3K signaling and ACT1/TRAF6/TAK1-dependent NF-kappaB activation by IL-17A in enhancing cytokine expression in human airway epithelial cells.
17947700 2007 Biomechanical signals suppress TAK1 activation to inhibit NF-kappaB transcriptional activation in fibrochondrocytes.
17828308 2008 TAK1 is required for TGF-beta 1-mediated regulation of matrix metalloproteinase-9 and metastasis.
17709393 2007 Vaccinia-related kinase 2 modulates the stress response to hypoxia mediated by TAK1.
17626013 2007 Constitutive activation of TAK1 by HTLV-1 tax-dependent overexpression of TAB2 induces activation of JNK-ATF2 but not IKK-NF-kappaB.
17608743 2007 YopJ targets TRAF proteins to inhibit TLR-mediated NF-kappaB, MAPK and IRF3 signal transduction.
17559674 2007 Regulation of the JNK pathway by TGF-beta activated kinase 1 in rheumatoid arthritis synoviocytes.
17548520 2007 Deubiquitinating enzyme CYLD negatively regulates the ubiquitin-dependent kinase Tak1 and prevents abnormal T cell responses.
17496917 2007 Ubiquitin-mediated activation of TAK1 and IKK.
17449468 2007 RBCK1 negatively regulates tumor necrosis factor- and interleukin-1-triggered NF-kappaB activation by targeting TAB2/3 for degradation.
17379600 2007 Effect of inositol hexakisphosphate kinase 2 on transforming growth factor beta-activated kinase 1 and NF-kappaB activation.
17363973 2007 Retroviral oncoprotein Tax deregulates NF-kappaB by activating Tak1 and mediating the physical association of Tak1-IKK.
17325661 2007 TAK1 represses transcription of the human telomerase reverse transcriptase gene.
17276978 2007 TAK1 MAPK kinase kinase mediates transforming growth factor-beta signaling by targeting SnoN oncoprotein for degradation.
17202147 2007 Heat shock protein 27 functions in inflammatory gene expression and transforming growth factor-beta-activated kinase-1 (TAK1)-mediated signaling.
17173073 2007 Overload of the heat-shock protein H11/HspB8 triggers melanoma cell apoptosis through activation of transforming growth factor-beta-activated kinase 1.
17158449 2007 TAK1-dependent signaling requires functional interaction with TAB2/TAB3.
17114179 2007 Gamma-tocotrienol inhibits nuclear factor-kappaB signaling pathway through inhibition of receptor-interacting protein and TAK1 leading to suppression of antiapoptotic gene products and potentiation of apoptosis.
17110930 2006 An antiapoptotic protein, c-FLIPL, directly binds to MKK7 and inhibits the JNK pathway.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17079228 2006 Protein phosphatase 6 down-regulates TAK1 kinase activation in the IL-1 signaling pathway.
17047224 2006 Regulation and function of IKK and IKK-related kinases.
16893890 2006 Osmotic stress activates the TAK1-JNK pathway while blocking TAK1-mediated NF-kappaB activation: TAO2 regulates TAK1 pathways.
16845370 2006 The Yersinia enterocolitica effector YopP inhibits host cell signalling by inactivating the protein kinase TAK1 in the IL-1 signalling pathway.
16840345 2006 Vaccinia virus B1R kinase interacts with JIP1 and modulates c-Jun-dependent signaling.
16835226 2006 Mammalian TAK1 activates Snf1 protein kinase in yeast and phosphorylates AMP-activated protein kinase in vitro.
16527194 2006 [New genes candidates for ectodermal dysplasia: TAB2, TRAF6 and TAK1].
16498455 2006 Osteoclast differentiation requires TAK1 and MKK6 for NFATc1 induction and NF-kappaB transactivation by RANKL.
16446357 2006 TAK1 is a component of the Epstein-Barr virus LMP1 complex and is essential for activation of JNK but not of NF-kappaB.
16301747 2005 PKC beta regulates BCR-mediated IKK activation by facilitating the interaction between TAK1 and CARMA1.
16293250 2005 TAK1-mediated transcriptional activation of CD28-responsive element and AP-1-binding site within the IL-2 promoter in Jurkat T cells.
16289117 2005 Structural basis for the interaction of TAK1 kinase with its activating protein TAB1.
16280329 2006 The C-terminal activating region 2 of the Epstein-Barr virus-encoded latent membrane protein 1 activates NF-kappaB through TRAF6 and TAK1.
16260783 2005 TAK1 is recruited to the tumor necrosis factor-alpha (TNF-alpha) receptor 1 complex in a receptor-interacting protein (RIP)-dependent manner and cooperates with MEKK3 leading to NF-kappaB activation.
16251197 2005 TAB2, TRAF6 and TAK1 are involved in NF-kappaB activation induced by the TNF-receptor, Edar and its adaptator Edaradd.
16186825 2005 Essential function for the kinase TAK1 in innate and adaptive immune responses.
16153868 2005 VISA is an adapter protein required for virus-triggered IFN-beta signaling.
16000313 2005 15S-Lipoxygenase-2 mediates arachidonic acid-stimulated adhesion of human breast carcinoma cells through the activation of TAK1, MKK6, and p38 MAPK.
15917296 2005 Inhibition of the transforming growth factor beta (TGFbeta) pathway by interleukin-1beta is mediated through TGFbeta-activated kinase 1 phosphorylation of SMAD3.
15894542 2005 Disabled-2 (Dab2) mediates transforming growth factor beta (TGFbeta)-stimulated fibronectin synthesis through TGFbeta-activated kinase 1 and activation of the JNK pathway.
15764709 2005 STAT3 regulates Nemo-like kinase by mediating its interaction with IL-6-stimulated TGFbeta-activated kinase 1 for STAT3 Ser-727 phosphorylation.
15670770 2005 TRAF-dependent association of protein kinase Tpl2/COT1 (MAP3K8) with CD40.
15590691 2005 Critical roles of threonine 187 phosphorylation in cellular stress-induced rapid and transient activation of transforming growth factor-beta-activated kinase 1 (TAK1) in a signaling complex containing TAK1-binding protein TAB1 and TAB2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15277532 2004 Sef interacts with TAK1 and mediates JNK activation and apoptosis.
15276183 2004 MD-2: the Toll 'gatekeeper' in endotoxin signalling.
15125833 2004 The TRAF6 ubiquitin ligase and TAK1 kinase mediate IKK activation by BCL10 and MALT1 in T lymphocytes.
15082531 2004 Wnt-1 signal induces phosphorylation and degradation of c-Myb protein via TAK1, HIPK2, and NLK.
15075345 2004 Reciprocal cross-talk between Nod2 and TAK1 signaling pathways.
14982987 2004 Toll-like receptor 3-mediated activation of NF-kappaB and IRF3 diverges at Toll-IL-1 receptor domain-containing adapter inducing IFN-beta.
14960582 2004 Wnt activates the Tak1/Nemo-like kinase pathway.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14670075 2004 TAB3, a new binding partner of the protein kinase TAK1.
14592977 2003 Feedback control of the protein kinase TAK1 by SAPK2a/p38alpha.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12874243 2003 Pellino3, a novel member of the Pellino protein family, promotes activation of c-Jun and Elk-1 and may act as a scaffolding protein.
12859960 2003 A dominant negative TAK1 inhibits cellular fibrotic responses induced by TGF-beta.
12842894 2003 Tumor necrosis factor-alpha-induced IKK phosphorylation of NF-kappaB p65 on serine 536 is mediated through the TRAF2, TRAF5, and TAK1 signaling pathway.
12804775 2003 Pellino2 activates the mitogen activated protein kinase pathway.
12609980 2003 Poly(I-C)-induced Toll-like receptor 3 (TLR3)-mediated activation of NFkappa B and MAP kinase is through an interleukin-1 receptor-associated kinase (IRAK)-independent pathway employing the signaling components TLR3-TRAF6-TAK1-TAB2-PKR .
12589052 2003 Transforming growth factor-beta1 (TGF-beta)-induced apoptosis of prostate cancer cells involves Smad7-dependent activation of p38 by TGF-beta-activated kinase 1 and mitogen-activated protein kinase kinase 3.
12556533 2003 Regulation of the interleukin-1-induced signaling pathways by a novel member of the protein phosphatase 2C family (PP2Cepsilon).
12547194 2003 TAK1 is critical for IkappaB kinase-mediated activation of the NF-kappaB pathway.
12496252 2003 Pellino 1 is required for interleukin-1 (IL-1)-mediated signaling through its interaction with the IL-1 receptor-associated kinase 4 (IRAK4)-IRAK-tumor necrosis factor receptor-associated factor 6 (TRAF6) complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12372426 2002 TAK1-TAB1 fusion protein: a novel constitutively active mitogen-activated protein kinase kinase kinase that stimulates AP-1 and NF-kappaB signaling pathways.
12296995 2002 TAK1-dependent activation of AP-1 and c-Jun N-terminal kinase by receptor activator of NF-kappaB.
12242293 2002 Interleukin-1 (IL-1) receptor-associated kinase-dependent IL-1-induced signaling complexes phosphorylate TAK1 and TAB2 at the plasma membrane and activate TAK1 in the cytosol.
12089335 2002 Role of NF kappa B activator Act1 in CD40-mediated signaling in epithelial cells.
12048196 2002 ILPIP, a novel anti-apoptotic protein that enhances XIAP-mediated activation of JNK1 and protection against apoptosis.
11865055 2002 IAP suppression of apoptosis involves distinct mechanisms: the TAK1/JNK1 signaling cascade and caspase inhibition.
11809792 2002 Receptor activator of NF-kappaB ligand (RANKL) activates TAK1 mitogen-activated protein kinase kinase kinase through a signaling complex containing RANK, TAB2, and TRAF6.
11585904 2001 Raf kinase inhibitor protein interacts with NF-kappaB-inducing kinase and TAK1 and inhibits NF-kappaB activation.
11460167 2001 TAK1 is a ubiquitin-dependent kinase of MKK and IKK.
11397816 2001 Involvement of Hgs/Hrs in signaling for cytokine-mediated c-fos induction through interaction with TAK1 and Pak1.
11259596 2001 Interleukin-1 (IL-1) receptor-associated kinase leads to activation of TAK1 by inducing TAB2 translocation in the IL-1 signaling pathway.
11118615 2000 Alternative splicing and gene structure of the transforming growth factor beta-activated kinase 1.
11104763 2001 Regulation of the TAK1 signaling pathway by protein phosphatase 2C.
10921914 2000 ASK1 inhibits interleukin-1-induced NF-kappa B activity through disruption of TRAF6-TAK1 interaction.
10882101 2000 TAB2, a novel adaptor protein, mediates activation of TAK1 MAPKKK by linking TAK1 to TRAF6 in the IL-1 signal transduction pathway.
10838074 2000 Phosphorylation-dependent activation of TAK1 mitogen-activated protein kinase kinase kinase by TAB1.
10807933 2000 Activation of NF-kappa B by XIAP, the X chromosome-linked inhibitor of apoptosis, in endothelial cells involves TAK1.
10779355 2000 IkappaB kinase alpha (IKKalpha) regulation of IKKbeta kinase activity.
10748100 2000 BMP2-induced apoptosis is mediated by activation of the TAK1-p38 kinase pathway that is negatively regulated by Smad6.
10702308 2000 TAK1 mitogen-activated protein kinase kinase kinase is activated by autophosphorylation within its activation loop.
10224067 1999 Hematopoietic progenitor kinase 1 is a component of transforming growth factor beta-induced c-Jun N-terminal kinase signaling cascade.
10195894 1999 Positive and negative regulation of IkappaB kinase activity through IKKbeta subunit phosphorylation.
10187861 1999 Functional interactions of transforming growth factor beta-activated kinase 1 with IkappaB kinases to stimulate NF-kappaB activation.
10094049 1999 The kinase TAK1 can activate the NIK-I kappaB as well as the MAP kinase cascade in the IL-1 signalling pathway.
10066798 1999 pp60(v-src) induction of cyclin D1 requires collaborative interactions between the extracellular signal-regulated kinase, p38, and Jun kinase pathways. A role for cAMP response element-binding protein and activating transcription factor-2 in pp60(v-src) signaling in breast cancer cells.
10022904 1999 Activation of IkappaB kinase beta by protein kinase C isoforms.
9744859 1998 Tumor necrosis factor receptor-associated factors (TRAFs)--a family of adapter proteins that regulates life and death.
9689078 1998 MEKK1 activates both IkappaB kinase alpha and IkappaB kinase beta.
9556573 1998 Regulation of peroxisome proliferator-activated receptor alpha-induced transactivation by the nuclear orphan receptor TAK1/TR4.
9480845 1998 TGF-beta-activated kinase 1 stimulates NF-kappa B activation by an NF-kappa B-inducing kinase-independent mechanism.
9466656 1998 Molecular cloning of human TAK1 and its mutational analysis in human lung cancer.
9380693 1997 Transforming growth factor beta-induced phosphorylation of Smad3 is required for growth inhibition and transcriptional induction in epithelial cells.
9278437 1997 Activation of the hematopoietic progenitor kinase-1 (HPK1)-dependent, stress-activated c-Jun N-terminal kinase (JNK) pathway by transforming growth factor beta (TGF-beta)-activated kinase (TAK1), a kinase mediator of TGF beta signal transduction.
9162092 1997 Characterization of the mitogen-activated protein kinase kinase 4 (MKK4)/c-Jun NH2-terminal kinase 1 and MKK3/p38 pathways regulated by MEK kinases 2 and 3. MEK kinase 3 activates MKK3 but does not cause activation of p38 kinase in vivo.
9079627 1997 TAK1 mediates the ceramide signaling to stress-activated protein kinase/c-Jun N-terminal kinase.
8663074 1996 A novel kinase cascade mediated by mitogen-activated protein kinase kinase 6 and MKK3.
8638164 1996 TAB1: an activator of the TAK1 MAPKKK in TGF-beta signal transduction.
8533096 1995 Identification of a member of the MAPKKK family as a potential mediator of TGF-beta signal transduction.
7708055 1994 TAK1: molecular cloning and characterization of a new member of the nuclear receptor superfamily.
3031469 1987 Analysis of mutation in human cells by using an Epstein-Barr virus shuttle system.