Property Summary

Ligand Count 1
NCBI Gene PubMed Count 12
PubMed Score 17.37
PubTator Score 12.53

Knowledge Summary

Patent (2,091)

TINX Plot

  Disease (4)

Disease Target Count
Hereditary Diffuse Gastric Cancer 3
Disease Target Count P-value
lung carcinoma 2843 4.5e-15
tuberculosis 2010 1.2e-06
pituitary cancer 1972 2.5e-06
psoriasis 6694 2.2e-05
ovarian cancer 8520 4.0e-04
lung cancer 4740 1.1e-03
cutaneous lupus erythematosus 1057 1.8e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count
Gastric Cancer, Hereditary Diffuse 12

Expression

  Differential Expression (7)

Disease log2 FC p
cutaneous lupus erythematosus -1.200 1.8e-03
lung cancer -1.100 1.1e-03
lung carcinoma -1.400 4.5e-15
ovarian cancer 1.400 4.0e-04
pituitary cancer -1.100 2.5e-06
psoriasis 2.900 2.2e-05
tuberculosis 1.100 1.2e-06

Gene RIF (7)

AA Sequence

MAGPCPRSGAERAGSCWQDPLAVALSRGRQLAAPPGRGCARSRPLSVVYVLTREPQPGLEPREGTEAEPL      1 - 70
PLRCLREACAQVPRPRPPPQLRSLPFGTLELGDTAALDAFYNADVVVLEVSSSLVQPSLFYHLGVRESFS     71 - 140
MTNNVLLCSQADLPDLQALREDVFQKNSDCVGSYTLIPYVVTATGRVLCGDAGLLRGLADGLVQAGVGTE    141 - 210
ALLTPLVGRLARLLEATPTDSCGYFRETIRRDIRQARERFSGPQLRQELARLQRRLDSVELLSPDIIMNL    211 - 280
LLSYRDVQDYSAIIELVETLQALPTCDVAEQHNVCFHYTFALNRRNRPGDRAKALSVLLPLVQLEGSVAP    281 - 350
DLYCMCGRIYKDMFFSSGFQDAGHREQAYHWYRKAFDVEPSLHSGINAAVLLIAAGQHFEDSKELRLIGM    351 - 420
KLGCLLARKGCVEKMQYYWDVGFYLGAQILANDPTQVVLAAEQLYKLNAPIWYLVSVMETFLLYQHFRPT    421 - 490
PEPPGGPPRRAHFWLHFLLQSCQPFKTACAQGDQCLVLVLEMNKVLLPAKLEVRGTDPVSTVTLSLLEPE    491 - 560
TQDIPSSWTFPVASICGVSASKRDERCCFLYALPPAQDVQLCFPSVGHCQWFCGLIQAWVTNPDSTAPAE    561 - 630
EAEGAGEMLEFDYEYTETGERLVLGKGTYGVVYAGRDRHTRVRIAIKEIPERDSRFSQPLHEEIALHRRL    631 - 700
RHKNIVRYLGSASQGGYLKIFMEEVPGGSLSSLLRSVWGPLKDNESTISFYTRQILQGLGYLHDNHIVHR    701 - 770
DIKGDNVLINTFSGLLKISDFGTSKRLAGITPCTETFTGTLQYMAPEIIDQGPRGYGKAADIWSLGCTVI    771 - 840
EMATGRPPFHELGSPQAAMFQVGMYKVHPPMPSSLSAEAQAFLLRTFEPDPRLRASAQTLLGDPFLQPGK    841 - 910
RSRSPSSPRHAPRPSDAPSASPTPSANSTTQSQTFPCPQAPSQHPPSPPKRCLSYGGTSQLRVPEEPAAE    911 - 980
EPASPEESSGLSLLHQESKRRAMLAAVLEQELPALAENLHQEQKQEQGARLGRNHVEELLRCLGAHIHTP    981 - 1050
NRRQLAQELRALQGRLRAQGLGPALLHRPLFAFPDAVKQILRKRQIRPHWMFVLDSLLSRAVRAALGVLG   1051 - 1120
PEVEKEAVSPRSEELSNEGDSQQSPGQQSPLPVEPEQGPAPLMVQLSLLRAETDRLREILAGKEREYQAL   1121 - 1190
VQRALQRLNEEARTYVLAPEPPTALSTDQGLVQWLQELNVDSGTIQMLLNHSFTLHTLLTYATRDDLIYT   1191 - 1260
RIRGGMVCRIWRAILAQRAGSTPVTSGP                                             1261 - 1288
//

Text Mined References (20)

PMID Year Title