Property Summary

NCBI Gene PubMed Count 190
PubMed Score 467.70
PubTator Score 288.64

Knowledge Summary

Patent (19,893)

Expression

  Differential Expression (22)

Disease log2 FC p
Rheumatoid Arthritis 1.300 3.6e-02
chronic lymphocytic leukemia 1.454 1.7e-05
malignant mesothelioma -4.900 5.2e-09
psoriasis 1.900 1.0e-04
ependymoma -1.200 5.0e-06
glioblastoma -2.000 4.3e-03
group 3 medulloblastoma -2.400 5.0e-05
astrocytoma 1.900 5.2e-03
atypical teratoid / rhabdoid tumor -3.400 2.5e-08
medulloblastoma, large-cell -3.400 1.3e-04
primitive neuroectodermal tumor -2.800 3.0e-04
adrenocortical carcinoma -1.775 7.0e-05
intraductal papillary-mucinous neoplasm ... -1.200 2.8e-03
lung cancer -2.600 6.7e-05
active Crohn's disease 1.028 2.1e-02
active ulcerative colitis 1.474 3.2e-02
pediatric high grade glioma -1.500 2.6e-03
aldosterone-producing adenoma -1.444 4.3e-02
lung carcinoma 1.200 1.2e-15
spina bifida -1.059 4.0e-02
Pick disease 1.100 6.5e-05
ovarian cancer -1.700 4.8e-05

Protein-protein Interaction (4)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (150)

PMID Text
27045525 ASK1 signalling regulates brown and beige adipocyte function.
26773495 Together, we suggest that 4SC-202 activates ASK1-dependent mitochondrial apoptosis pathway to potently inhibit human HCC cells.
26707143 curcumin and ABT-737 on HCC cells was investigated for the first time, to the best of our knowledge. It was found that curcumin markedly enhanced the antitumor effects of ABT-737 on HepG2 cells and activate ROS-ASK1-c-Jun N-terminal kinase pathway . .
26694167 results suggest that baicalein-mediated ASK1/JNK activation regulates the mitochondria-dependent apoptosis pathway through the up-regulation of TAp63 and down-regulation of NF-kappaB and CD74/CD44 in B-cell malignancies
26661061 The present findings thus support our notion that ROR1 sustains lung adenocarcinoma survival, at least in part, through direct physical interaction with ASK1
26243192 Data show that the MAPKKK6 ASK2, a modulator of MAPKKK5 ASK1 signaling, was essential for ASK1-dependent apoptosis, but not for inducing interferon-beta (IFNB) expression.
26191261 The expression of ASK1 is correlated with the level of claudin-6 in cervical carcinoma cells and tissues.
26165383 These results implicate the TNF/TRAF2/ASK1/p38 kinase pathway in modulating risk of pulmonary complications.
26134265 TNF-alpha-induced ASK1-p38/JNK pathway is an important mediator of cytokine synthesis and enhanced expression of adhesion molecules in rheumatoid arthritis and is inhibited by thymoquinone.
26095851 Cyclophilin A regulates JNK/p38-MAPK signaling through its physical interaction with ASK1.
25982447 Data indicates that ASK1 expression is regulated by MiR-19a by targeting specific sites in the 3' untranslated region of its mRNA.
25901786 ASK1 stabilizes APOBEC3G and binds HIV-1 Vif, disrupting assemble of the Vif-ubiquitin ligase complex, thus restoring the antiviral activity of APOBEC3g.
25901786 ASK1 restricts the replication of HIV-1 by inhibiting Vif activity and promoting APOBEC3G incorporation into virions in CD4+ T-cells
25797626 Knockdown of IRE1alpha by siRNA dramatically abrogated CXC195-induced activation of TRAF2, ASK and JNK, formation of an IRE1alpha-TRAF2-ASK1 complex and caspase- and mitochondrial-dependent apoptosis in T24 cells
25752609 Because the phosphorylation site mutants of NR4A2 cannot rescue the cell death-promoting activity, ASK1-p38 pathway-dependent phosphorylation and subsequent cytoplasmic translocation of NR4A2 may be required for oxidative stress-induced cell death.
25391652 Siah1 is a substrate of ASK1 for activation of the GAPDH-Siah1 oxidative stress signaling cascade.
25135476 Data show that ASK1 is critical for IFN gamma-induced DAPK1 via ATF6 recruitment.
25116390 Collectively, these data reveal that activation of the PI3K/Akt pathway limits JNK-mediated apoptosis by phosphorylating and inactivating ASK1 during human enterovirus 71 infection.
25068797 Findings suggest that methyl isocyanate inhibits angiogenesis by inducing mitogen-activated protein kinase kinase kinase 5 ASK1-JNK-dependent endothelial cell death.
24912301 It is activated in response to various stresses, such as reactive oxygen species (ROS)and endoplasmic reticulum (ER) stress, and plays pivotal roles in a wide variety of cellular responses, including cell death, differentiation and inflammation. (review)
24574456 TNF-signaling dependence of ASK1-mediated apoptosis in melanoma cells.
24448648 data suggest that degradation of ASK1 mediated by Roquin-2 is an evolutionarily conserved mechanism required for the appropriate regulation of stress responses, including pathogen resistance and cell death
24082073 In gastric epithelial cells, H. pylori activates ASK1 in a reactive oxygen species - and cag pathogenicity island-dependent manner, and ASK1 regulates sustained JNK activation and apoptosis induced by H. pylori.
24008424 MAP3K5 R256C mutation revealed attenuation of MKK4 activation through increased binding of the inhibitory protein thioredoxin (TXN/TRX-1/Trx), resulting in increased proliferation and anchorage-independent growth of melanoma cells.
23986795 ASK1 restricts the replication of HIV-1 by inhibiting Vif activity and promoting APOBEC3G incorporation into virions in CD4+ T-cells
23982205 Data indicate that the ASK1-FoxO3a-TRADD-caspase 8 pathway is present in neural tube defects (NTDs)-affected tissues.
23847689 ASK1 restricts the replication of HIV-1 by inhibiting Vif activity and promoting APOBEC3G incorporation into virions in CD4+ T-cells
23799149 Identification of the domain through which HIV-1 Nef interacts with ASK1 and inhibits its function.
23799149 ASK1 restricts the replication of HIV-1 by inhibiting Vif activity and promoting APOBEC3G incorporation into virions in CD4+ T-cells
23744074 The models confirmed the reaction order, revealed processivity in the phosphorylation of MEK6 by ASK1, and suggested that the order of phosphorylation is dictated by both binding and catalysis rates.
23580093 Activation of ASK1/JNK signaling pathways by oridonin induces growth inhibition and apoptosis in cultured HuH-6 cells.
23569274 ASK1 signal cascades are negatively regulated by Notch1-IC.
23556445 Our data suggest that these MAP3K5 variants are indicative of beta-thalassemia disease severity and response to HU treatment.
23416061 ER stress-induced ASK1-p38 activation, which is triggered by the accumulation of Ins(C96Y), plays an important role in the pathogenesis of diabetes.
23382671 ASK1 restricts the replication of HIV-1 by inhibiting Vif activity and promoting APOBEC3G incorporation into virions in CD4+ T-cells
23319048 Which activates the ASK-1 kinase pathway.
23219526 These results indicate that IL-6 activation occurs through ASK1 and p38, which in turn activates AP-1, resulting in the activation of VEGF expression.
23102700 Suggest that Slim/KLHDC10 is an activator of ASK1, contributing to oxidative stress-induced cell death through the suppression of PP5.
23087182 Ask1 is a direct target of miR-20a. Overexpression of miR-20a led to a global decrease in ASK1 protein in BLP- and LPS-activated cells indicating that miR-20a regulates the expression of ASK1 at the translational level.
23031789 ASK1 activates c-jun N-terminal kinase and p38 in response to various stimuli such as oxidative stress, endoplasmic reticulum stress, infection and calcium influx. (Review)
23015639 Report changes in ASK1 cell signaling associated with ischemic/idiopathic cardiomyopathies.
22925655 ASK1 signal may play a positive role in the inhibitory effect of claudin-6 in breast cancer.
22844345 ASK1 restricts the replication of HIV-1 by inhibiting Vif activity and promoting APOBEC3G incorporation into virions in CD4+ T-cells
22723553 A novel mechanism underlying the regulation of survival in normal and malignant plasma cells by ASK1.
22609355 MCRS2 plays a negative role in stress-induced ASK1 activation.
22399290 S100A1 and permanently active S100P inhibited the apoptosis signal-regulating kinase 1 (ASK1) and PP5 interaction, resulting the inhibition of dephosphorylation of phospho-ASK1 by PP5
22197930 It was found that 24% of melanoma cell lines have mutations in the protein-coding regions of either MAP3K5 or MAP3K9.
22167179 TAK1 and its adapter protein, TAB2, reciprocally regulate both TAK1- and ASK1-mediated signaling pathways to direct the activations of NF-kappaB and AP-1.
22095282 Results indicate that arginine methylation of ASK1 by PRMT1 contributes to the regulation of stress-induced signaling that controls a variety of cellular events including apoptosis.
21771788 ZPR9 was found to physically interact with ASK1 through a disulfide linkage;ZPR9 functions as a novel positive regulator of ASK1.
21764682 The expression of MAP3K5 and miR-BART22 is inversely correlated, suggesting the possibility of MAP3K5 to serve as target gene of EBV miR-BART22 in nasopharyngeal carcinoma.
21738216 Stimulation of human aortic endothelial cells with TNF-alpha led to an increased expression of p73 protein and a reduction in the levels of p53 involving apoptosis signal-regulating kinase 1 (ASK1).
21725208 These results suggest that p34 (SEI-1) inhibits ROS-induced cell death through by indirectly inducing ubiquitination of ASK1.
21594902 apoptosis signal-regulating kinase 1 has a role in chondrosarcoma cell apoptosis along with endoplasmic reticulum stress due to FPipTB
21510938 knockdown of TXNIP prevented high glucose-induced cell apoptosis and activation of ASK1 may be via reduction of oxidative stress in mesangial cells.
21496457 Data show that ASK1 stabilizes SMN protein by inhibiting SMN poly-ubiquitination.
21383696 a monitoring mechanism of c-Myc and ASK1/p38 against abnormal ribosome biogenesis through controlling the stability and activity of p53 protein
21378396 iron chelators significantly reduced ASK1-thioredoxin complex formation, resulting in the increased phosphorylation of ASK1, which activates the JNK and p38 pathways
21187402 Apoptosis signal-regulating kinase 1 and cyclin D1 compose a positive feedback loop contributing to tumor growth in gastric cancer
20800594 the blockage of the GSK-3beta-beta-catenin pathway resulting from the knockdown of ASK1 modulates the migration of breast cancer cells.
20674765 Data suggest that, despite structural divergence, PPEF and PP5 phosphatases may share common interacting partners and functions.
20661259 TLR4-mediated SphK1 activation was found to be critical for the redox-dependent activation of HIF-1alpha and ASK1, and the prevention of lipopolysaccharide-induced activation of caspase 3 and the expression interleukin-6.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20609399 ASK1 may be critical for the development of rheumatoid arthritis (RA) and ASK1 may be involved in the production of proinflammatory mediators in response to TNF-alpha stimulation in the RA joint.
20601186 These results indicate that the ASK1-p38 MAPK cascade may regulate LPS-induced TF expression in pulmonary microvasculature.
20512919 These results strongly indicate ST13 mediated by adenovirus triggers colorectal cell apoptosis via ASK1-JNK signaling cascade
20430109 Down-regulation of thioredoxin, increased intracellular reactive oxygen species, and activation of ASK1-ERK/p38 MAPK signaling all were associated with Japanese encephalitis virus-induced apoptosis.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20364819 data suggest that oxidative stress rapidly increases ASK1 catalytic efficiency for MKK6 phosphorylation by increasing MKK6 binding affinity within the ASK1
20213747 DJ-1, by directly inhibiting ASK1, may act as a negative regulator in ASK1 signaling cascades.
20185809 ASK1 variants may increase susceptibility to type 2 diabetes by decreasing insulin sensitivity via reduced ASK1 expression.
20185809 Observational study of gene-disease association. (HuGE Navigator)
20130137 These results reveal that, during influenza A virus infection, the PI3K/Akt pathway negatively regulates the JNK pathway via ASK1, thereby inhibiting JNK-dependent, Bax-mediated apoptosis.
20068037 ASK1 restricts the replication of HIV-1 by inhibiting Vif activity and promoting APOBEC3G incorporation into virions in CD4+ T-cells
20048146 apoptosis inducers also induced phosphorylation of ASK1 in a ROS-dependent manner. Suppression of ASK1 expression blocked the effects of apoptosis, in hypertonic conditions, on both regulatory volume increase induction and Akt activation
20035634 genes MAP3K5 and PDIA3 are associated with malignant stages of prostate cancer and therefore provide novel potential biomarkers
19961619 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19940360 Study shows an essential role for apoptosis signal-regulating kinase 1 (ASK1), together with both c-jun-N-terminal kinase (JNK) and p38 pathways, and caspase-8 in Fas-induced apoptosis.
19935702 Upstream signals couple ASK2 S964 phosphorylation to the ASK1 signalosome through dual engagement of 14-3-3.
19920149 results provide evidence that PDK1 and ASK1 directly interact and phosphorylate each other and act as negative regulators of their respective kinases in resting cells
19913121 Observational study of gene-disease association. (HuGE Navigator)
19903888 Data show that DAB2IP is a potent growth inhibitor by inducing G(0)/G(1) cell cycle arrest and is proapoptotic in response to stress, and that DAB2IP can suppress the PI3K-Akt pathway and enhance ASK1 activation leading to cell apoptosis.
19880523 STRAP can act as a negative regulator of ASK1.
19748889 Inhibition of apoptosis by GIP is mediated via a key pathway involving Akt-dependent inhibition of apoptosis signal-regulating kinase 1, which subsequently prevents the pro-apoptotic actions of p38 MAPK and JNK.
19590015 Results suggest that this member of the PGAM family has crossed over from small molecules to protein substrates and been adapted to serve as a specialized activator of ASK1.
19570911 Data show that Cys250 is essential for H(2)O(2)-dependent JNK signaling downstream from ASK1 but at a step subsequent to the phosphorylation of ASK1 Thr838.
19449444 ASK1 restricts the replication of HIV-1 by inhibiting Vif activity and promoting APOBEC3G incorporation into virions in CD4+ T-cells
19351724 An Ask1-MKK4-p38MAPK/JNK pathway reflects adipocyte stress associated with adipose tissue inflammation, linking visceral adiposity to whole-body insulin resistance in obesity.
19306926 beta-Arrestins play a negative regulatory role in hydroegn peroxide-induced apoptosis signaling through associating with ASK1 and CHIP and facilitating ASK1 degradation.
19293155 Cytoprotective binding of DJ-1 to ASK1 depends on the central redox-sensitive Cys-106 and may be modulated by peripheral cysteine residues.
19287004 JAK2-SOCS1 and SHP2 reciprocally regulate ASK1 phosphorylation and stability in response to cytokines.
19149577 ASK1 restricts the replication of HIV-1 by inhibiting Vif activity and promoting APOBEC3G incorporation into virions in CD4+ T-cells
19004820 an essential role for ASK1 in cell death induced by ER stress.
19001375 the molecular interactions of arrestin2 and arrestin3 and their individual domains with the components of the two MAPK cascades, ASK1-MKK4-JNK3 and c-Raf-1-MEK1-ERK2
18841476 Data show that nitric oxide derived from S-nitrosoglutathione activates ASK1 in THP-1 human myeloid macrophages, induces accumulation of HIF-1alpha protein, and induces accumulation of p53 in normal but not HIF-1alpha knockdown THP-1 cells.
18822283 DDTD, an isoflavone derivative, induces cell apoptosis through the reactive oxygen species/apoptosis signal-regulating kinase 1 pathway in human osteosarcoma cells.
18759454 The precursor of atrial natriuretic peptide, natriuretic peptide precursor (NPPA), physically interacts with the N-terminus of apoptosis signal-regulating kinase 1 (ASK1), negatively impacting NPPA processing and/or secretion.
18501712 These findings suggest a negative role of Prx-1 in ASK1-induced apoptosis.
18380010 Data suggest that in nonapoptotic cells, endogenous ASK1 protein is normally cleaved at a number of specific sites, some of which are in the kinase domain.
18327563 Data suggest that sequence variations of ASK1 and MAP2K6 lead to partially sex-specific changes in the levels and/or phosphorylation states of p38 and p38-regulated proteins that might contribute to the observed delaying effects in the age of onset of HD.
18292600 PP2A and AIP1 cooperatively induce activation of ASK1-JNK signaling and vascular endothelial cell apoptosis.
18219322 SENP1 mediates TNF-induced desumoylation and translocation of HIPK1, leading to an enhanced ASK1-dependent apoptosis.
18211888 ROS-mediated activation of the ASK1-p38 MAPK pathway downstream of P2X(7) receptor is required for ATP-induced apoptosis in macrophages.
18178252 The present study thus defines a novel role for ASK1 as a mediator of C5b-9-dependent cell injury.
18054391 present study shows that inhibition of PI3 kinase by LY294002 in THP-1 cells exposed to LPS attenuated down-regulation of ASK1 activity followed by programmed cell death
18028450 these results indicate that activation of the ASK1/p38 MAPK/p47phox cascade plays a central role in PPD/TLR2-induced ROS generation and suggests the existence of a 'ROS/ASK1' inflammatory amplification feedback loop in monocytes/macrophages.
17937911 the structure of the human ASK1 catalytic domain in complex with staurosporine
17883330 discusses the molecular mechanisms by which ASK1 functions in stress and immune responses and discuss the possible involvement of ASK1 in human diseases [review]
17827388 Observational study of gene-disease association. (HuGE Navigator)
17652454 These results indicate that Ask1 oxidation is required at a step subsequent to activation for signaling downstream of Ask1 after H(2)O(2) treatment.
17595347 ASK1 expression levels can be regulated by G alpha13, at least in part via control of ASK1 ubiquitination and degradation
17543279 ghrelin inhibits ASK1-mediated apoptosis and ASK1 activation by a mechanism involving induction of HSP70
17541429 Gemin5 functions as a scaffold protein for the ASK1-JNK1 signaling module and thereby potentiates ASK1-mediated signaling events.
17456047 These results suggest that PP2Cepsilon maintains ASK1 in an inactive state by dephosphorylation in quiescent cells, supporting the possibility that PP2Cepsilon and PP5 play different roles in H2O2-induced regulation of ASK1 activity.
17389591 TNF-induced TRAF2-RIP1-AIP1-ASK1 complex formation and for the activation of ASK1-JNK/p38 apoptotic signaling.
17331470 ASK1 is activated by arsenic trioxide through reactive oxygen species accumulation and may negatively regulate apoptosis in leukemic cells without activating p38 and JNK
17325029 Binding of cyclin-dependent kinase inhibitor 1A to ASK1 requires ASK1 kinase function and may involve phosphorylation of S98
17244475 Current findings for the relationship between pathogenesis and ASK1-MAPK pathways.
17220297 TNFR2 signaling induces selective c-IAP1-dependent ASK1 ubiquitination and terminates mitogen-activated protein kinase signaling
17210579 Apoptosis signal-regulating kinase (ASK) 2 functions as a mitogen-activated protein kinase kinase kinase in a heteromeric complex with ASK1.
16644673 TNF-alpha increases mitochondrial ROS and activates ASK1 in human hepaatoma cells and these TNF-alpha-induced phenomena contribute to impaired insulin signaling.
16636664 Glutathione S-transferase P1-1 attenuate TRAF2-enhanced apoptosis signal-regulating kinase 1 (ASK1) (MAP3K5)autophosphorylation
16532036 reactive oxygen species generated by Nox4, at least in part, transmit cell survival signals through the AKT-ASK1 pathway in pancreatic cancer cells and their depletion leads to apoptosis.
16515547 This study clearly shows the route from ROS generation by 6-OHDA to initiation of p38/JNK signalling via activation of ASK1 in the studied Parkinson disease model.
16512785 E2 promoter-binding factors regulate the expression of ASK1. overexpression and RNA interference experiments support the requirement of endogenous E2F/DP (E2F dimerization partner) activity for ASK-1 expression.
16476732 concomitant induction of E2F1 targets ASK1 and Bim by HDACIs warrants an effective activation of E2F1-dependent apoptosis in response to suberoylanilide hydroxamic acid
15925322 Raf-1 may mediate its anti-apoptotic function by interrupting ASK1-dependent phosphorylation of ALG-2.
15864780 ASK1-p38 cascade regulates the innate immunity of the skin by forming an immune barrier consisting of hBD, LL37, and TLR2 during epidermal differentiation.
15843568 ASK1 kinase is a central player upstream of p38 MAPK activation when secreted Helicobacter pylori antigen HP0175 effects induction of apopotosis in human gastric epithelial cell line AGS.
15782121 Hsp90-Akt forms a complex with ASK1 and protect vascular endothelium from stress-induced apoptosis.
15755722 PKD is a critical mediator in H2O2- but not TNF-induced ASK1-JNK signaling
15701637 TNFalpha-induced desumoylation and cytoplasmic translocation of HIPK1 are critical in TNFalpha-induced ASK1-JNK/p38 activation
15670787 Taken together, our data suggested that the JNK/c-Jun signaling cascade plays a crucial role in Cd-induced neuronal cell apoptosis and provides a molecular linkage between oxidative stress and neuronal apoptosis.
15328343 PP5 plays an important role in the survival of cells in a low oxygen environment by suppressing a hypoxia-induced ASK-1/MKK4/JNK signaling cascade that promotes an apoptotic response
15310755 AIP1 is a novel transducer in TNF-induced TRAF2-dependent activation of ASK1 that mediates a balance between JNK versus NF-kappaB signaling
15246877 apoptosis signal-regulating kinase 1 is activated by S-nitrosation of thioredoxin in the nitrogen monoxide/superoxide system
15218033 ASK1 signaling is activated by PP5, which is regulated by mTOR
15210709 apoptosis signal-regulating kinase 1 binds directly to retinoblastoma protein and has roles in apoptotic signaling and cell cycle
14688258 ASK1 is regulated by reactive oxygen species through dephosphorylation at serine 967 and 14-3-3 dissociation
14668338 results suggest that nitric oxide mediates the interferon-gamma-induced inhibition of apoptosis signal regulating kinase 1(ASK1) in L929 cells through a thiolredox mechanism
12968034 glucose deprivation activates the ASK1-SEK1-JNK1-HIPK1 pathway, relocalizing Daxx from the nucleus to the cytoplasm, where Daxx binds to ASK1, and subsequently leads to ASK1 oligomerization
12813029 These data suggest that AIP1 mediates TNF-alpha-induced ASK1 activation by facilitating dissociation of inhibitor 14-3-3 from ASK1, a novel mechanism by which TNF-alpha activates ASK1.
12566458 ASK1 is one of the factors involved in the caspase-independent pathway of LTbetaR-induced cell death.
12556535 Type 1 insulin-like growth factor receptor (IGF-IR) signaling inhibits apoptosis through this enzyme.
12482984 Tumorigenic mutants of p53 bind to Daxx and inhibit Daxx-dependent activation of the apoptosis signal-regulating kinase 1 stress-inducible kinases and Jun NH(2)-terminal kinase.
12473108 ASK1 binds to PKR and is involved in apoptosis signalling pathways
12189133 role in activating the JNK and p38 MAP kinase cascades in response to environmental stresses such as reactive oxygen species
11493600 Ask1 has a caspase-independent killing function independent of kinase activity and activable by interaction with Daxx. Induced after translocation of Daxx from the nucleus to the cytoplasm, which occurs following activation of the death receptor Fas.
11323689 ASK1 restricts the replication of HIV-1 by inhibiting Vif activity and promoting APOBEC3G incorporation into virions in CD4+ T-cells
11298454 ASK1 restricts the replication of HIV-1 by inhibiting Vif activity and promoting APOBEC3G incorporation into virions in CD4+ T-cells

AA Sequence

MSTEADEGITFSVPPFAPSGFCTIPEGGICRRGGAAAVGEGEEHQLPPPPPGSFWNVESAAAPGIGCPAA      1 - 70
TSSSSATRGRGSSVGGGSRRTTVAYVINEASQGQLVVAESEALQSLREACETVGATLETLHFGKLDFGET     71 - 140
TVLDRFYNADIAVVEMSDAFRQPSLFYHLGVRESFSMANNIILYCDTNSDSLQSLKEIICQKNTMCTGNY    141 - 210
TFVPYMITPHNKVYCCDSSFMKGLTELMQPNFELLLGPICLPLVDRFIQLLKVAQASSSQYFRESILNDI    211 - 280
RKARNLYTGKELAAELARIRQRVDNIEVLTADIVINLLLSYRDIQDYDSIVKLVETLEKLPTFDLASHHH    281 - 350
VKFHYAFALNRRNLPGDRAKALDIMIPMVQSEGQVASDMYCLVGRIYKDMFLDSNFTDTESRDHGASWFK    351 - 420
KAFESEPTLQSGINYAVLLLAAGHQFESSFELRKVGVKLSSLLGKKGNLEKLQSYWEVGFFLGASVLAND    421 - 490
HMRVIQASEKLFKLKTPAWYLKSIVETILIYKHFVKLTTEQPVAKQELVDFWMDFLVEATKTDVTVVRFP    491 - 560
VLILEPTKIYQPSYLSINNEVEEKTISIWHVLPDDKKGIHEWNFSASSVRGVSISKFEERCCFLYVLHNS    561 - 630
DDFQIYFCTELHCKKFFEMVNTITEEKGRSTEEGDCESDLLEYDYEYDENGDRVVLGKGTYGIVYAGRDL    631 - 700
SNQVRIAIKEIPERDSRYSQPLHEEIALHKHLKHKNIVQYLGSFSENGFIKIFMEQVPGGSLSALLRSKW    701 - 770
GPLKDNEQTIGFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETFT    771 - 840
GTLQYMAPEIIDKGPRGYGKAADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKVHPEIPESMSAE    841 - 910
AKAFILKCFEPDPDKRACANDLLVDEFLKVSSKKKKTQPKLSALSAGSNEYLRSISLPVPVLVEDTSSSS    911 - 980
EYGSVSPDTELKVDPFSFKTRAKSCGERDVKGIRTLFLGIPDENFEDHSAPPSPEEKDSGFFMLRKDSER    981 - 1050
RATLHRILTEDQDKIVRNLMESLAQGAEEPKLKWEHITTLIASLREFVRSTDRKIIATTLSKLKLELDFD   1051 - 1120
SHGISQVQVVLFGFQDAVNKVLRNHNIKPHWMFALDSIIRKAVQTAITILVPELRPHFSLASESDTADQE   1121 - 1190
DLDVEDDHEEQPSNQTVRRPQAVIEDAVATSGVSTLSSTVSHDSQSAHRSLNVQLGRMKIETNRLLEELV   1191 - 1260
RKEKELQALLHRAIEEKDQEIKHLKLKSQPIEIPELPVFHLNSSGTNTEDSELTDWLRVNGADEDTISRF   1261 - 1330
LAEDYTLLDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKQT                             1331 - 1374
//

Text Mined References (211)

PMID Year Title
27045525 2016 ASK1 signalling regulates brown and beige adipocyte function.
26773495 2016 4SC-202 activates ASK1-dependent mitochondrial apoptosis pathway to inhibit hepatocellular carcinoma cells.
26707143 2016 Curcumin enhances the antitumor effect of ABT-737 via activation of the ROS-ASK1-JNK pathway in hepatocellular carcinoma cells.
26694167 2016 ASK1/JNK-mediated TAp63 activation controls the cell survival signal of baicalein-treated EBV-transformed B cells.
26661061 2016 Receptor tyrosine kinase-like orphan receptor 1, a target of NKX2-1/TTF-1 lineage-survival oncogene, inhibits apoptosis signal-regulating kinase 1-mediated pro-apoptotic signaling in lung adenocarcinoma.
26243192 2015 The ASK family kinases differentially mediate induction of type I interferon and apoptosis during the antiviral response.
26191261 2015 Expression of apoptosis signal-regulating kinase 1 is associated with tight junction protein claudin-6 in cervical carcinoma.
26165383 2015 Genetic variation in the TNF/TRAF2/ASK1/p38 kinase signaling pathway as markers for postoperative pulmonary complications in lung cancer patients.
26134265 2015 Thymoquinone inhibits TNF-?-induced inflammation and cell adhesion in rheumatoid arthritis synovial fibroblasts by ASK1 regulation.
26095851 2015 Cyclophilin A regulates JNK/p38-MAPK signaling through its physical interaction with ASK1.
25982447 2015 MicroRNA-19a regulates lipopolysaccharide-induced endothelial cell apoptosis through modulation of apoptosis signal-regulating kinase 1 expression.
25901786 2015 ASK1 restores the antiviral activity of APOBEC3G by disrupting HIV-1 Vif-mediated counteraction.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25797626 2015 IRE1?-TRAF2-ASK1 complex-mediated endoplasmic reticulum stress and mitochondrial dysfunction contribute to CXC195-induced apoptosis in human bladder carcinoma T24 cells.
25752609 2015 Apoptosis Signal-regulating Kinase 1 (ASK1)-p38 Pathway-dependent Cytoplasmic Translocation of the Orphan Nuclear Receptor NR4A2 Is Required for Oxidative Stress-induced Necrosis.
25391652 2015 Role of apoptosis signal-regulating kinase 1 (ASK1) as an activator of the GAPDH-Siah1 stress-signaling cascade.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25135476 2014 Regulation of the death-associated protein kinase 1 expression and autophagy via ATF6 requires apoptosis signal-regulating kinase 1.
25116390 2014 Activation of PI3K/Akt pathway limits JNK-mediated apoptosis during EV71 infection.
25068797 2014 Carbamoylating activity associated with the activation of the antitumor agent laromustine inhibits angiogenesis by inducing ASK1-dependent endothelial cell death.
24912301 2014 [ASK1-MAP kinase signaling pathway as a therapeutic target for human diseases].
24574456 2014 Atmospheric gas plasma-induced ROS production activates TNF-ASK1 pathway for the induction of melanoma cancer cell apoptosis.
24448648 2014 Roquin-2 promotes ubiquitin-mediated degradation of ASK1 to regulate stress responses.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24082073 2013 Differential roles of ASK1 and TAK1 in Helicobacter pylori-induced cellular responses.
24008424 2014 Somatic mutations in MAP3K5 attenuate its proapoptotic function in melanoma through increased binding to thioredoxin.
23982205 2013 Maternal hyperglycemia activates an ASK1-FoxO3a-caspase 8 pathway that leads to embryonic neural tube defects.
23799149 2013 Dynamics of physical interaction between HIV-1 Nef and ASK1: identifying the interacting motif(s).
23744074 2013 Precisely ordered phosphorylation reactions in the p38 mitogen-activated protein (MAP) kinase cascade.
23580093 2013 ER stress and ASK1-JNK activation contribute to oridonin-induced apoptosis and growth inhibition in cultured human hepatoblastoma HuH-6 cells.
23569274 2013 Notch1 modulates oxidative stress induced cell death through suppression of apoptosis signal-regulating kinase 1.
23556445 2013 Genomic variation in the MAP3K5 gene is associated with ?-thalassemia disease severity and hydroxyurea treatment efficacy.
23416061 2013 Involvement of ASK1-p38 pathway in the pathogenesis of diabetes triggered by pancreatic ß cell exhaustion.
23319048 2013 SCO2 induces p53-mediated apoptosis by Thr845 phosphorylation of ASK-1 and dissociation of the ASK-1-Trx complex.
23219526 2013 Interleukin-6 induces vascular endothelial growth factor expression and promotes angiogenesis through apoptosis signal-regulating kinase 1 in human osteosarcoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23102700 2012 The Kelch repeat protein KLHDC10 regulates oxidative stress-induced ASK1 activation by suppressing PP5.
23087182 2013 MiR-20a regulates ASK1 expression and TLR4-dependent cytokine release in rheumatoid fibroblast-like synoviocytes.
23031789 2013 Activation mechanisms of ASK1 in response to various stresses and its significance in intracellular signaling.
23015639 2013 Association of DJ-1/PTEN/AKT- and ASK1/p38-mediated cell signalling with ischaemic cardiomyopathy.
23000344 2013 Ursolic acid induces ER stress response to activate ASK1-JNK signaling and induce apoptosis in human bladder cancer T24 cells.
22925655 2012 Apoptosis signal-regulating kinase 1 is associated with the effect of claudin-6 in breast cancer.
22723553 2012 ASK1 promotes apoptosis of normal and malignant plasma cells.
22609355 2012 Microspherule protein 2 associates with ASK1 and acts as a negative regulator of stress-induced ASK1 activation.
22399290 2012 S100 proteins modulate protein phosphatase 5 function: a link between CA2+ signal transduction and protein dephosphorylation.
22197930 2011 Frequent somatic mutations in MAP3K5 and MAP3K9 in metastatic melanoma identified by exome sequencing.
22167179 2012 Reciprocal inhibition between the transforming growth factor-?-activated kinase 1 (TAK1) and apoptosis signal-regulating kinase 1 (ASK1) mitogen-activated protein kinase kinase kinases and its suppression by TAK1-binding protein 2 (TAB2), an adapter protein for TAK1.
22095282 2012 Arginine methylation-dependent regulation of ASK1 signaling by PRMT1.
21771788 2011 Positive regulation of apoptosis signal-regulating kinase 1 signaling by ZPR9 protein, a zinc finger protein.
21764682 2011 [Relationship between MAP3K5 and Epstein-Barr virus-encoded miR-BART22 expression in nasopharyngeal carcinoma].
21738216 2012 TNF-? response of vascular endothelial and vascular smooth muscle cells involve differential utilization of ASK1 kinase and p73.
21725208 2011 p34 (SEI-1) inhibits ROS-induced cell death through suppression of ASK1.
21594902 2012 FPipTB, a benzimidazole derivative, induces chondrosarcoma cell apoptosis via endoplasmic reticulum stress and apoptosis signal-regulating kinase 1.
21510938 2011 Knockdown of thioredoxin interacting protein attenuates high glucose-induced apoptosis and activation of ASK1 in mouse mesangial cells.
21496457 2011 Stabilization of the survival motor neuron protein by ASK1.
21383696 2011 Aberrant ribosome biogenesis activates c-Myc and ASK1 pathways resulting in p53-dependent G1 arrest.
21378396 2011 Cellular iron depletion stimulates the JNK and p38 MAPK signaling transduction pathways, dissociation of ASK1-thioredoxin, and activation of ASK1.
21187402 2011 Apoptosis signal-regulating kinase 1 and cyclin D1 compose a positive feedback loop contributing to tumor growth in gastric cancer.
20800594 2010 Knockdown of apoptosis signal-regulating kinase 1 modulates basal glycogen synthase kinase-3? kinase activity and regulates cell migration.
20674765 2010 Protein phosphatase with EF-hand domains 2 (PPEF2) is a potent negative regulator of apoptosis signal regulating kinase-1 (ASK1).
20661259 2011 The involvement of sphingosine kinase 1 in LPS-induced Toll-like receptor 4-mediated accumulation of HIF-1? protein, activation of ASK1 and production of the pro-inflammatory cytokine IL-6.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20609399 2010 Critical role for apoptosis signal-regulating kinase 1 in the development of inflammatory K/BxN serum-induced arthritis.
20601186 2010 Apoptosis signal-regulating kinase 1-mediated signaling pathway regulates lipopolysaccharide-induced tissue factor expression in pulmonary microvasculature.
20512919 2010 ASK1-JNK signaling cascade mediates Ad-ST13-induced apoptosis in colorectal HCT116 cells.
20430109 2010 Japanese encephalitis virus down-regulates thioredoxin and induces ROS-mediated ASK1-ERK/p38 MAPK activation in human promonocyte cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20364819 2010 Mechanism of oxidative stress-induced ASK1-catalyzed MKK6 phosphorylation.
20358250 2010 Positive regulation of apoptosis signal-regulating kinase 1 by dual-specificity phosphatase 13A.
20213747 2010 DJ-1 modulates the p38 mitogen-activated protein kinase pathway through physical interaction with apoptosis signal-regulating kinase 1.
20185809 2010 Variants in ASK1 are associated with skeletal muscle ASK1 expression, in vivo insulin resistance, and type 2 diabetes in Pima Indians.
20130137 2010 The PI3K/Akt pathway inhibits influenza A virus-induced Bax-mediated apoptosis by negatively regulating the JNK pathway via ASK1.
20048146 2010 Inhibition of protein kinase Akt1 by apoptosis signal-regulating kinase-1 (ASK1) is involved in apoptotic inhibition of regulatory volume increase.
20035634 2009 Differential expression of apoptotic genes PDIA3 and MAP3K5 distinguishes between low- and high-risk prostate cancer.
19961619 2009 A pooling-based genome-wide analysis identifies new potential candidate genes for atopy in the European Community Respiratory Health Survey (ECRHS).
19940360 2009 Fas-induced apoptosis of renal cell carcinoma is mediated by apoptosis signal-regulating kinase 1 via mitochondrial damage-dependent caspase-8 activation.
19935702 2010 Dual engagement of 14-3-3 proteins controls signal relay from ASK2 to the ASK1 signalosome.
19920149 2010 Reciprocal negative regulation of PDK1 and ASK1 signaling by direct interaction and phosphorylation.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19903888 2009 DAB2IP coordinates both PI3K-Akt and ASK1 pathways for cell survival and apoptosis.
19880523 2010 Serine-threonine kinase receptor-associated protein inhibits apoptosis signal-regulating kinase 1 function through direct interaction.
19782076 2009 A scanning peptide array approach uncovers association sites within the JNK/beta arrestin signalling complex.
19749799 2009 PIM1 phosphorylates and negatively regulates ASK1-mediated apoptosis.
19748889 2009 Suppression of p38 MAPK and JNK via Akt-mediated inhibition of apoptosis signal-regulating kinase 1 constitutes a core component of the beta-cell pro-survival effects of glucose-dependent insulinotropic polypeptide.
19590015 2009 Mitochondrial phosphoglycerate mutase 5 uses alternate catalytic activity as a protein serine/threonine phosphatase to activate ASK1.
19570911 2009 REDOX reaction at ASK1-Cys250 is essential for activation of JNK and induction of apoptosis.
19389260 2009 The roles of ASK family proteins in stress responses and diseases.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19351724 2009 Activated Ask1-MKK4-p38MAPK/JNK stress signaling pathway in human omental fat tissue may link macrophage infiltration to whole-body Insulin sensitivity.
19306926 2009 beta-Arrestins facilitate ubiquitin-dependent degradation of apoptosis signal-regulating kinase 1 (ASK1) and attenuate H2O2-induced apoptosis.
19293155 2009 Oxidizable residues mediating protein stability and cytoprotective interaction of DJ-1 with apoptosis signal-regulating kinase 1.
19287004 2009 JAK2 and SHP2 reciprocally regulate tyrosine phosphorylation and stability of proapoptotic protein ASK1.
19004820 2009 Chemical biology investigation of cell death pathways activated by endoplasmic reticulum stress reveals cytoprotective modulators of ASK1.
19001375 2009 How does arrestin assemble MAPKs into a signaling complex?
18948261 2008 Murine protein serine/threonine kinase 38 activates apoptosis signal-regulating kinase 1 via Thr 838 phosphorylation.
18841476 2008 Apoptosis signal-regulating kinase 1 (ASK1) and HIF-1alpha protein are essential factors for nitric oxide-dependent accumulation of p53 in THP-1 human myeloid macrophages.
18822283 2008 DDTD, an isoflavone derivative, induces cell apoptosis through the reactive oxygen species/apoptosis signal-regulating kinase 1 pathway in human osteosarcoma cells.
18759454 2008 Apoptosis signal-regulating kinase 1 attenuates atrial natriuretic peptide secretion.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18501712 2008 A novel function of peroxiredoxin 1 (Prx-1) in apoptosis signal-regulating kinase 1 (ASK1)-mediated signaling pathway.
18408005 2008 The beta-arrestin-2 scaffold protein promotes c-Jun N-terminal kinase-3 activation by binding to its nonconserved N terminus.
18380010 2008 A 39 kDa fragment of endogenous ASK1 suggests specific cleavage not degradation by the proteasome.
18327563 2008 ASK1 and MAP2K6 as modifiers of age at onset in Huntington's disease.
18292600 2008 AIP1 recruits phosphatase PP2A to ASK1 in tumor necrosis factor-induced ASK1-JNK activation.
18219322 2008 SENP1 mediates TNF-induced desumoylation and cytoplasmic translocation of HIPK1 to enhance ASK1-dependent apoptosis.
18211888 2008 Requirement of reactive oxygen species-dependent activation of ASK1-p38 MAPK pathway for extracellular ATP-induced apoptosis in macrophage.
18178252 2008 Role of apoptosis signal-regulating kinase 1 in complement-mediated glomerular epithelial cell injury.
18088087 2008 Phosphoproteome of resting human platelets.
18054391 2008 PI3 kinase and direct S-nitrosation are involved in down-regulation of apoptosis signal-regulating kinase 1 during LPS-induced Toll-like receptor 4 signalling.
18028450 2008 ASK1-p38 MAPK-p47phox activation is essential for inflammatory responses during tuberculosis via TLR2-ROS signalling.
17937911 2007 Structural and functional characterization of the human protein kinase ASK1.
17883330 2008 Apoptosis signal-regulating kinase 1 in stress and immune response.
17827388 2007 Genetic variation in 1253 immune and inflammation genes and risk of non-Hodgkin lymphoma.
17724081 2007 Thioredoxin and TRAF family proteins regulate reactive oxygen species-dependent activation of ASK1 through reciprocal modulation of the N-terminal homophilic interaction of ASK1.
17652454 2007 Disulfide Bond-mediated multimerization of Ask1 and its reduction by thioredoxin-1 regulate H(2)O(2)-induced c-Jun NH(2)-terminal kinase activation and apoptosis.
17595347 2007 Regulation of apoptosis signal-regulating kinase 1 degradation by G alpha13.
17543279 2007 Ghrelin inhibits apoptosis signal-regulating kinase 1 activity via upregulating heat-shock protein 70.
17541429 2007 Positive regulation of ASK1-mediated c-Jun NH(2)-terminal kinase signaling pathway by the WD-repeat protein Gemin5.
17456047 2007 Regulation of apoptosis signal-regulating kinase 1 by protein phosphatase 2Cepsilon.
17389591 2007 RIP1-mediated AIP1 phosphorylation at a 14-3-3-binding site is critical for tumor necrosis factor-induced ASK1-JNK/p38 activation.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17331470 2007 ASK1 is activated by arsenic trioxide in leukemic cells through accumulation of reactive oxygen species and may play a negative role in induction of apoptosis.
17325029 2007 Negative regulation of ASK1 by p21Cip1 involves a small domain that includes Serine 98 that is phosphorylated by ASK1 in vivo.
17292829 2007 p38alpha MAP kinase as a sensor of reactive oxygen species in tumorigenesis.
17244475 2007 Pathophysiological roles of ASK1-MAP kinase signaling pathways.
17220297 2007 Tumor necrosis factor receptor 2 signaling induces selective c-IAP1-dependent ASK1 ubiquitination and terminates mitogen-activated protein kinase signaling.
17210579 2007 Apoptosis signal-regulating kinase (ASK) 2 functions as a mitogen-activated protein kinase kinase kinase in a heteromeric complex with ASK1.
16648474 2006 Direct interaction and reciprocal regulation between ASK1 and calcineurin-NFAT control cardiomyocyte death and growth.
16644673 2006 Impact of mitochondrial reactive oxygen species and apoptosis signal-regulating kinase 1 on insulin signaling.
16636664 2006 Human glutathione S-transferase P1-1 interacts with TRAF2 and regulates TRAF2-ASK1 signals.
16532036 2006 Inhibition of NADPH oxidase 4 activates apoptosis via the AKT/apoptosis signal-regulating kinase 1 pathway in pancreatic cancer PANC-1 cells.
16515547 2006 Critical role of ASK1 in the 6-hydroxydopamine-induced apoptosis in human neuroblastoma SH-SY5Y cells.
16512785 2006 ASK-1 (apoptosis signal-regulating kinase 1) is a direct E2F target gene.
16476732 2006 Apoptosis signal-regulating kinase 1 is a direct target of E2F1 and contributes to histone deacetylase inhibitor-induced apoptosis through positive feedback regulation of E2F1 apoptotic activity.
16449798 2006 Thioredoxin-ASK1 complex levels regulate ROS-mediated p38 MAPK pathway activity in livers of aged and long-lived Snell dwarf mice.
16407264 2006 SOCS1 inhibits tumor necrosis factor-induced activation of ASK1-JNK inflammatory signaling by mediating ASK1 degradation.
16316999 2006 Induction of apoptosis by the Ste20-like kinase SLK, a germinal center kinase that activates apoptosis signal-regulating kinase and p38.
16129676 2005 Recruitment of tumor necrosis factor receptor-associated factor family proteins to apoptosis signal-regulating kinase 1 signalosome is essential for oxidative stress-induced cell death.
16049941 2005 A pilot proteomic study of amyloid precursor interactors in Alzheimer's disease.
16038411 2005 C-terminus of heat shock protein 70-interacting protein facilitates degradation of apoptosis signal-regulating kinase 1 and inhibits apoptosis signal-regulating kinase 1-dependent apoptosis.
15983381 2005 Interaction of DJ-1 with Daxx inhibits apoptosis signal-regulating kinase 1 activity and cell death.
15925322 2005 Apoptosis-linked gene-2 connects the Raf-1 and ASK1 signalings.
15866172 2005 Conserved docking site is essential for activation of mammalian MAP kinase kinases by specific MAP kinase kinase kinases.
15864780 2005 New mechanisms of skin innate immunity: ASK1-mediated keratinocyte differentiation regulates the expression of beta-defensins, LL37, and TLR2.
15843568 2005 The secreted peptidyl prolyl cis,trans-isomerase HP0175 of Helicobacter pylori induces apoptosis of gastric epithelial cells in a TLR4- and apoptosis signal-regulating kinase 1-dependent manner.
15782121 2005 Hsp90-Akt phosphorylates ASK1 and inhibits ASK1-mediated apoptosis.
15755722 2005 Protein kinase D specifically mediates apoptosis signal-regulating kinase 1-JNK signaling induced by H2O2 but not tumor necrosis factor.
15701637 2005 Tumor necrosis factor alpha-induced desumoylation and cytoplasmic translocation of homeodomain-interacting protein kinase 1 are critical for apoptosis signal-regulating kinase 1-JNK/p38 activation.
15670787 2005 Identification of ASK1, MKK4, JNK, c-Jun, and caspase-3 as a signaling cascade involved in cadmium-induced neuronal cell apoptosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15328343 2004 Ser/Thr protein phosphatase 5 inactivates hypoxia-induced activation of an apoptosis signal-regulating kinase 1/MKK-4/JNK signaling cascade.
15310755 2004 AIP1/DAB2IP, a novel member of the Ras-GAP family, transduces TRAF2-induced ASK1-JNK activation.
15246877 2004 S-nitrosation of thioredoxin in the nitrogen monoxide/superoxide system activates apoptosis signal-regulating kinase 1.
15218033 2004 Inhibition of mammalian target of rapamycin activates apoptosis signal-regulating kinase 1 signaling by suppressing protein phosphatase 5 activity.
15210709 2004 Direct binding of apoptosis signal-regulating kinase 1 to retinoblastoma protein: novel links between apoptotic signaling and cell cycle machinery.
15094778 2004 Negative control of apoptosis signal-regulating kinase 1 through phosphorylation of Ser-1034.
15023544 2004 Interaction of apoptosis signal-regulating kinase 1 with isoforms of 14-3-3 proteins.
14761963 2004 Positive regulation of apoptosis signal-regulating kinase 1 by hD53L1.
14749717 2004 Involvement of ASK1 in Ca2+-induced p38 MAP kinase activation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14688258 2004 Activation of apoptosis signal-regulating kinase 1 by reactive oxygen species through dephosphorylation at serine 967 and 14-3-3 dissociation.
14668338 2004 Inhibition of apoptosis signal-regulating kinase 1 by nitric oxide through a thiol redox mechanism.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12968034 2003 Role of the ASK1-SEK1-JNK1-HIPK1 signal in Daxx trafficking and ASK1 oligomerization.
12912994 2003 PB1 domains of MEKK2 and MEKK3 interact with the MEK5 PB1 domain for activation of the ERK5 pathway.
12819028 2003 ASK1 associates with troponin T and induces troponin T phosphorylation and contractile dysfunction in cardiomyocytes.
12813029 2003 AIP1 mediates TNF-alpha-induced ASK1 activation by facilitating dissociation of ASK1 from its inhibitor 14-3-3.
12697749 2003 AKT2 inhibition of cisplatin-induced JNK/p38 and Bax activation by phosphorylation of ASK1: implication of AKT2 in chemoresistance.
12566458 2003 The role of apoptosis signal-regulating kinase 1 in lymphotoxin-beta receptor-mediated cell death.
12556535 2003 Type 1 insulin-like growth factor receptor (IGF-IR) signaling inhibits apoptosis signal-regulating kinase 1 (ASK1).
12543931 2002 Toward a human blood serum proteome: analysis by multidimensional separation coupled with mass spectrometry.
12482984 2003 Inhibition of stress-inducible kinase pathways by tumorigenic mutant p53.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12473108 2002 Double-stranded RNA-activated protein kinase interacts with apoptosis signal-regulating kinase 1. Implications for apoptosis signaling pathways.
12391142 2002 Heat shock protein hsp72 is a negative regulator of apoptosis signal-regulating kinase 1.
12372597 2002 Interaction of ALG-2 with ASK1 influences ASK1 localization and subsequent JNK activation.
12244106 2002 Role of glutaredoxin in metabolic oxidative stress. Glutaredoxin as a sensor of oxidative stress mediated by H2O2.
12189133 2002 Phosphorylation-dependent scaffolding role of JSAP1/JIP3 in the ASK1-JNK signaling pathway. A new mode of regulation of the MAP kinase cascade.
12089063 2002 Thioredoxin promotes ASK1 ubiquitination and degradation to inhibit ASK1-mediated apoptosis in a redox activity-independent manner.
12077134 2002 Activation of the p38 signaling pathway by heat shock involves the dissociation of glutathione S-transferase Mu from Ask1.
12050113 2002 ASK1 is essential for endoplasmic reticulum stress-induced neuronal cell death triggered by expanded polyglutamine repeats.
11959862 2002 Scaffold role of a mitogen-activated protein kinase phosphatase, SKRP1, for the JNK signaling pathway.
11920685 2002 Activation of apoptosis signal-regulating kinase 1 by the stress-induced activating phosphorylation of pre-formed oligomer.
11689443 2001 Negative feedback regulation of ASK1 by protein phosphatase 5 (PP5) in response to oxidative stress.
11495919 2001 Apoptosis signal-regulating kinase 1 controls the proapoptotic function of death-associated protein (Daxx) in the cytoplasm.
11493600 2001 A kinase-independent function of Ask1 in caspase-independent cell death.
11427728 2001 Raf-1 promotes cell survival by antagonizing apoptosis signal-regulating kinase 1 through a MEK-ERK independent mechanism.
11416155 2001 The cell cycle-regulatory CDC25A phosphatase inhibits apoptosis signal-regulating kinase 1.
11356842 2001 Identification of a motif in the carboxyl terminus of beta -arrestin2 responsible for activation of JNK3.
11336675 2001 Crystal structure of the 14-3-3zeta:serotonin N-acetyltransferase complex. a role for scaffolding in enzyme regulation.
11298454 2001 HIV-1 Nef inhibits ASK1-dependent death signalling providing a potential mechanism for protecting the infected host cell.
11278289 2001 Glutathione S-transferase mu modulates the stress-activated signals by suppressing apoptosis signal-regulating kinase 1.
11154276 2001 Akt phosphorylates and negatively regulates apoptosis signal-regulating kinase 1.
11096076 2001 Glutamine-dependent antiapoptotic interaction of human glutaminyl-tRNA synthetase with apoptosis signal-regulating kinase 1.
11090355 2000 Beta-arrestin 2: a receptor-regulated MAPK scaffold for the activation of JNK3.
11029458 2001 Apoptosis signal-regulating kinase 1 (ASK1) is an intracellular inducer of keratinocyte differentiation.
11003656 2000 Inhibition of Daxx-mediated apoptosis by heat shock protein 27.
10921914 2000 ASK1 inhibits interleukin-1-induced NF-kappa B activity through disruption of TRAF6-TAK1 interaction.
10849426 2000 Execution of apoptosis signal-regulating kinase 1 (ASK1)-induced apoptosis by the mitochondria-dependent caspase activation.
10734135 2000 Apoptosis signal-regulating kinase 1 (ASK1) induces neuronal differentiation and survival of PC12 cells.
10688666 2000 Activation of apoptosis signal-regulating kinase 1 (ASK1) by tumor necrosis factor receptor-associated factor 2 requires prior dissociation of the ASK1 inhibitor thioredoxin.
10523862 1999 Mediation of TNF receptor-associated factor effector functions by apoptosis signal-regulating kinase-1 (ASK1).
10411906 1999 Suppression of apoptosis signal-regulating kinase 1-induced cell death by 14-3-3 proteins.
9875215 1998 MAPKKK6, a novel mitogen-activated protein kinase kinase kinase, that associates with MAPKKK5.
9774977 1998 ASK1 is essential for JNK/SAPK activation by TRAF2.
9743501 1998 Activation of apoptosis signal-regulating kinase 1 (ASK1) by the adapter protein Daxx.
9651337 1998 Reactive oxygen species- and dimerization-induced activation of apoptosis signal-regulating kinase 1 in tumor necrosis factor-alpha signal transduction.
9564042 1998 Mammalian thioredoxin is a direct inhibitor of apoptosis signal-regulating kinase (ASK) 1.
9465908 1997 Chromosomal localization of four MAPK signaling cascade genes: MEK1, MEK3, MEK4 and MEKK5.
8974401 1997 Induction of apoptosis by ASK1, a mammalian MAPKKK that activates SAPK/JNK and p38 signaling pathways.
8940179 1996 Molecular cloning and characterization of a novel protein kinase with a catalytic domain homologous to mitogen-activated protein kinase kinase kinase.