Property Summary

NCBI Gene PubMed Count 36
PubMed Score 13.58
PubTator Score 171.02

Knowledge Summary

Patent (22,285)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (15)

PMID Text
26755636 ZAK is a key player in mammalian limb patterning in humans and mice.
25013376 The long non-coding RNA URHC promotes cell proliferation and inhibits apoptosis by repressing ZAK expression through inactivation of the ERK/MAPK pathway.
24807215 ZAK kinase isoform TV1 is preferentially upregulated in gastric tumours and cell lines relative to normal samples. This pattern is also observed in colorectal, bladder and breast cancers.
24170769 we report that sorafenib suppresses UV-induced apoptosis specifically by inhibiting c-jun-NH(2)-kinase (JNK) activation through the off-target inhibition of leucine zipper and sterile alpha motif-containing kinase (ZAK)
23319595 MRK is a novel RhoC effector that controls LPA-stimulated cell invasion at least in part by regulating myosin dynamics, ERK and p38
21305317 The genes identified KTN1, ROCK1, and ZAK may be responsible for loss of cellular homeostasis in giant cells tumors of bone
20408143 In this study, by applying a novel method, we have identified the phosphorylation sites in human MSK1 mitogen- and stress-activated protein kinase 1, and show that MRK-beta could also activate MSK1 through direct interaction.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20331627 decrease of lung cancer cell proliferation by ZAK may involve the ERK and JNK pathways via an AP-1 transcription factor.
18331592 data demonstrate that a ZAK isoform(s) is the MAP3Kinase that transduces the ribotoxic stress response
15737997 Mixed lineage kinase 7 (MLK7), a splice variant of the ZAK gene, encodes an isoform which is the MAPKKK required for modulation of the stress-activated MAPKs downstream of anisomycin and UV stimulation.
15485649 ZAK induces characteristic hypertrophic growth features, including increased cell size, elevated atrial natriuretic factor expression, and increased actin fiber organization
15465036 Results suggest that a ZAK mediates TGF-beta-induced cardiac hypertrophic growth via a novel TGF-beta signaling pathway.
15342622 Data show that in response to radiation, MRK controls two independent pathways: the Chk2-Cdc25A pathway leading to cell cycle arrest and the p38gamma MAPK pathway
12535642 Results suggest that ZAK might play a role as an upstream signal to suppress the ZZaPK function and decrease E2F expression.

AA Sequence

MSSLGASFVQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLKIEKEAEILSVLSHRNIIQFYG      1 - 70
VILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAKGMHYLHMEAPVKVIHRDLKSRNVV     71 - 140
IAADGVLKICDFGASRFHNHTTHMSLVGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLE    141 - 210
GLQVAWLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNK    211 - 280
AEWRCEIEATLERLKKLERDLSFKEQELKERERRLKMWEQKLTEQSNTPLLPSFEIGAWTEDDVYCWVQQ    281 - 350
LVRKGDSSAEMSVYASLFKENNITGKRLLLLEEEDLKDMGIVSKGHIIHFKSAIEKLTHDYINLFHFPPL    351 - 420
IKDSGGEPEENEEKIVNLELVFGFHLKPGTGPQDCKWKMYMEMDGDEIAITYIKDVTFNTNLPDAEILKM    421 - 490
TKPPFVMEKWIVGIAKSQTVECTVTYESDVRTPKSTKHVHSIQWSRTKPQDEVKAVQLAIQTLFTNSDGN    491 - 560
PGSRSDSSADCQWLDTLRMRQIASNTSLQRSQSNPILGSPFFSHFDGQDSYAAAVRRPQVPIKYQQITPV    561 - 630
NQSRSSSPTQYGLTKNFSSLHLNSRDSGFSSGNTDTSSERGRYSDRSRNKYGRGSISLNSSPRGRYSGKS    631 - 700
QHSTPSRGRYPGKFYRVSQSALNPHQSPDFKRSPRDLHQPNTIPGMPLHPETDSRASEEDSKVSEGGWTK    701 - 770
VEYRKKPHRPSPAKTNKERARGDHRGWRNF                                            771 - 800
//

Text Mined References (47)

PMID Year Title
26755636 2016 Exome sequencing and CRISPR/Cas genome editing identify mutations of ZAK as a cause of limb defects in humans and mice.
25416956 2014 A proteome-scale map of the human interactome network.
25013376 2014 Long non-coding RNA URHC regulates cell proliferation and apoptosis via ZAK through the ERK/MAPK signaling pathway in hepatocellular carcinoma.
24807215 2014 Integrated exome and transcriptome sequencing reveals ZAK isoform usage in gastric cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24170769 2014 Sorafenib suppresses JNK-dependent apoptosis through inhibition of ZAK.
23319595 2013 The MLK-related kinase (MRK) is a novel RhoC effector that mediates lysophosphatidic acid (LPA)-stimulated tumor cell invasion.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21305317 2011 Differentially expressed genes in giant cell tumor of bone.
21224381 2011 A-kinase anchoring protein (AKAP)-Lbc anchors a PKN-based signaling complex involved in ?1-adrenergic receptor-induced p38 activation.
20408143 2010 Mapping of phosphorylation sites in human MSK1 activated by a novel interaction with MRK-beta.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20331627 2010 ZAK inhibits human lung cancer cell growth via ERK and JNK activation in an AP-1-dependent manner.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18331592 2008 ZAK: a MAP3Kinase that transduces Shiga toxin- and ricin-induced proinflammatory cytokine expression.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17192257 2007 Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15737997 2005 Complete inhibition of anisomycin and UV radiation but not cytokine induced JNK and p38 activation by an aryl-substituted dihydropyrrolopyrazole quinoline and mixed lineage kinase 7 small interfering RNA.
15684425 2005 Phosphorylation of Ser28 in histone H3 mediated by mixed lineage kinase-like mitogen-activated protein triple kinase alpha.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485649 2004 ZAK re-programs atrial natriuretic factor expression and induces hypertrophic growth in H9c2 cardiomyoblast cells.
15465036 2004 Transforming growth factor-beta induces the expression of ANF and hypertrophic growth in cultured cardiomyoblast cells through ZAK.
15342622 2004 The stress kinase MRK contributes to regulation of DNA damage checkpoints through a p38gamma-independent pathway.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15172994 2004 A novel role for mixed-lineage kinase-like mitogen-activated protein triple kinase alpha in neoplastic cell transformation and tumor development.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12761180 2003 Regulation of a mitogen-activated protein kinase kinase kinase, MLTK by PKN.
12535642 2003 A novel zinc finger protein, ZZaPK, interacts with ZAK and stimulates the ZAK-expressing cells re-entering the cell cycle.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12220515 2002 Mixed lineage kinase ZAK utilizing MKK7 and not MKK4 to activate the c-Jun N-terminal kinase and playing a role in the cell arrest.
11836244 2002 MRK, a mixed lineage kinase-related molecule that plays a role in gamma-radiation-induced cell cycle arrest.
11549352 2001 Tissue distribution and functional expression of a cDNA encoding a novel mixed lineage kinase.
11042189 2001 Identification and characterization of a novel MAP kinase kinase kinase, MLTK.
10924358 2000 Cloning and expression of ZAK, a mixed lineage kinase-like protein containing a leucine-zipper and a sterile-alpha motif.