Property Summary

Ligand Count 7
NCBI Gene PubMed Count 38
PubMed Score 14.89
PubTator Score 171.02

Knowledge Summary

Patent (22,285)

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
SPLIT-FOOT MALFORMATION WITH MESOAXIAL POLYDACTYLY 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (31)

Disease log2 FC p
active Crohn's disease 1.016 1.1e-02
acute myeloid leukemia -1.500 4.3e-02
adult high grade glioma 1.200 4.7e-03
Alzheimer's disease 1.200 1.9e-02
Astrocytoma, Pilocytic 1.100 8.3e-04
atypical teratoid / rhabdoid tumor 1.400 7.0e-07
breast carcinoma -1.500 1.0e-04
colon cancer 1.300 8.0e-03
ductal carcinoma in situ -1.300 3.0e-03
ependymoma 1.200 6.0e-07
fibroadenoma -1.600 4.7e-03
gastric carcinoma 1.600 1.9e-02
glioblastoma 1.500 3.5e-04
group 3 medulloblastoma 1.100 5.9e-04
invasive ductal carcinoma -1.258 1.4e-03
lung adenocarcinoma -1.500 2.7e-09
lung carcinoma -1.100 5.4e-14
malignant mesothelioma 1.500 3.5e-07
medulloblastoma, large-cell 1.400 8.6e-06
nasopharyngeal carcinoma 1.100 3.0e-03
osteosarcoma 1.098 2.2e-04
ovarian cancer -1.500 4.0e-04
pancreatic cancer 2.200 6.7e-05
permanent atrial fibrillation -1.500 8.3e-03
Pick disease 2.800 6.1e-07
pituitary cancer 1.200 1.9e-02
primary pancreatic ductal adenocarcinoma 2.433 4.3e-05
primitive neuroectodermal tumor 1.600 3.0e-03
subependymal giant cell astrocytoma 1.487 6.2e-03
tuberculosis -1.400 3.5e-05
ulcerative colitis 1.100 6.8e-07

Gene RIF (17)

AA Sequence

MSSLGASFVQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLKIEKEAEILSVLSHRNIIQFYG      1 - 70
VILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAKGMHYLHMEAPVKVIHRDLKSRNVV     71 - 140
IAADGVLKICDFGASRFHNHTTHMSLVGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLE    141 - 210
GLQVAWLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNK    211 - 280
AEWRCEIEATLERLKKLERDLSFKEQELKERERRLKMWEQKLTEQSNTPLLPSFEIGAWTEDDVYCWVQQ    281 - 350
LVRKGDSSAEMSVYASLFKENNITGKRLLLLEEEDLKDMGIVSKGHIIHFKSAIEKLTHDYINLFHFPPL    351 - 420
IKDSGGEPEENEEKIVNLELVFGFHLKPGTGPQDCKWKMYMEMDGDEIAITYIKDVTFNTNLPDAEILKM    421 - 490
TKPPFVMEKWIVGIAKSQTVECTVTYESDVRTPKSTKHVHSIQWSRTKPQDEVKAVQLAIQTLFTNSDGN    491 - 560
PGSRSDSSADCQWLDTLRMRQIASNTSLQRSQSNPILGSPFFSHFDGQDSYAAAVRRPQVPIKYQQITPV    561 - 630
NQSRSSSPTQYGLTKNFSSLHLNSRDSGFSSGNTDTSSERGRYSDRSRNKYGRGSISLNSSPRGRYSGKS    631 - 700
QHSTPSRGRYPGKFYRVSQSALNPHQSPDFKRSPRDLHQPNTIPGMPLHPETDSRASEEDSKVSEGGWTK    701 - 770
VEYRKKPHRPSPAKTNKERARGDHRGWRNF                                            771 - 800
//

Text Mined References (51)

PMID Year Title