Property Summary

Ligand Count 2
NCBI Gene PubMed Count 13
PubMed Score 83.81
PubTator Score 29.01

Knowledge Summary

Patent (8,268)

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.200 5.8e-04
atypical teratoid / rhabdoid tumor -1.200 2.1e-04
Breast cancer -2.400 4.3e-02
ependymoma -1.400 2.6e-13
glioblastoma -1.200 1.4e-08
group 4 medulloblastoma 1.100 3.5e-04
intraductal papillary-mucinous neoplasm ... 1.800 4.6e-04
lung cancer -1.400 5.2e-03
lung carcinoma 1.100 9.8e-13
medulloblastoma, large-cell 1.100 1.8e-02
non-small cell lung cancer 1.035 1.7e-14
osteosarcoma 2.155 2.1e-05
ovarian cancer 1.900 9.3e-05
subependymal giant cell astrocytoma -1.125 1.2e-02

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (4)

AA Sequence

MANFQEHLSCSSSPHLPFSESKTFNGLQDELTAMGNHPSPKLLEDQQEKGMVRTELIESVHSPVTTTVLT      1 - 70
SVSEDSRDQFENSVLQLREHDESETAVSQGNSNTVDGESTSGTEDIKIQFSRSGSGSGGFLEGLFGCLRP     71 - 140
VWNIIGKAYSTDYKLQQQDTWEVPFEEISELQWLGSGAQGAVFLGKFRAEEVAIKKVREQNETDIKHLRK    141 - 210
LKHPNIIAFKGVCTQAPCYCIIMEYCAHGQLYEVLRAGRKITPRLLVDWSTGIASGMNYLHLHKIIHRDL    211 - 280
KSPNVLVTHTDAVKISDFGTSKELSDKSTKMSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGE    281 - 350
IPYKDVDSSAIIWGVGSNSLHLPVPSTCPDGFKILMKQTWQSKPRNRPSFRQTLMHLDIASADVLATPQE    351 - 420
TYFKSQAEWREEVKKHFEKIKSEGTCIHRLDEELIRRRREELRHALDIREHYERKLERANNLYMELSAIM    421 - 490
LQLEMREKELIKREQAVEKKYPGTYKRHPVRPIIHPNAMEKLMKRKGVPHKSGMQTKRPDLLRSEGIPTT    491 - 560
EVAPTASPLSGSPKMSTSSSKSRYRSKPRHRRGNSRGSHSDFAAILKNQPAQENSPHPTYLHQAQSQYPS    561 - 630
LHHHNSLQQQYQQPPPAMSQSHHPRLNMHGQDIATCANNLRYFGPAAALRSPLSNHAQRQLPGSSPDLIS    631 - 700
TAMAADCWRSSEPDKGQAGPWGCCQADAYDPCLQCRPEQYGSLDIPSAEPVGRSPDLSKSPAHNPLLENA    701 - 770
QSSEKTEENEFSGCRSESSLGTSHLGTPPALPRKTRPLQKSGDDSSEEEEGEVDSEVEFPRRQRPHRCIS    771 - 840
SCQSYSTFSSENFSVSDGEEGNTSDHSNSPDELADKLEDRLAEKLDDLLSQTPEIPIDISSHSDGLSDKE    841 - 910
CAVRRVKTQMSLGKLCVEERGYENPMQFEESDCDSSDGECSDATVRTNKHYSSATW                  911 - 966
//

Text Mined References (15)

PMID Year Title