Property Summary

NCBI Gene PubMed Count 29
PubMed Score 114.87
PubTator Score 77.06

Knowledge Summary

Patent (19,919)

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Parkinson's disease 364 3.313 1.7

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -1.400 1.1e-05
psoriasis -2.400 1.9e-05
osteosarcoma -3.313 1.7e-08
group 3 medulloblastoma -1.300 4.1e-03
medulloblastoma, large-cell -1.600 1.4e-05
Pick disease -1.200 2.3e-05
ulcerative colitis -1.100 3.4e-05
ovarian cancer -1.100 4.4e-04

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (12)

PMID Text
25999017 miR-130a inhibited the JNK pathway by targeting MAP3K12, contributing to its anti-apoptotic effect and the maintenance of diabetic endothelial progenitor cell function.
25341110 Data suggest that specific pharmacological inhibition of dual leucine zipper kinase (DLK, MAP3K12) may have therapeutic potential in multiple indications of neuronal degeneration.
21893036 these findings indicate that DLK participates in cell proliferation and/or survival, at least in part, by modulating the expression of cell cycle regulatory proteins.
21526495 The results confirm the significance of apoptosis deregulation in CLL, and suggest a possible relationship between ZIPK expression and the clinical course of the disease.
19851984 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19730683 Observational study of gene-disease association. (HuGE Navigator)
19675578 the DLK-ERK signaling pathway may act as a regulator of the interaction that occurs between Hsp27 and the cytoskeleton during the formation of the cornified cell envelope, a process conferring to the skin its crucial barrier function
19146952 Src-dependent tyrosine phosphorylation recombinant human DLK was important for regulation of its activity. DLK may have a role in PDGF signaling.
18995835 DAPK-ZIPK-L13a axis forms a unique regulatory module that first represses, then repermits inflammatory gene expression.
15695824 DLK is a signaling molecule implicated in the regulation of keratinocyte terminal differentiation and cornification
15611134 ZIPK is positively regulated by phosphorylation within its kinase domain and contains an inhibitory C-terminal domain that controls enzyme activity.
14697235 for the selective expression of ZPK gene, cell-specific negative regulatory element(s) which locate outside of the core promoter region repress the potent basic promoter activity

AA Sequence

MACLHETRTPSPSFGGFVSTLSEASMRKLDPDTSDCTPEKDLTPTHVLQLHEQDAGGPGGAAGSPESRAS      1 - 70
RVRADEVRLQCQSGSGFLEGLFGCLRPVWTMIGKAYSTEHKQQQEDLWEVPFEEILDLQWVGSGAQGAVF     71 - 140
LGRFHGEEVAVKKVRDLKETDIKHLRKLKHPNIITFKGVCTQAPCYCILMEFCAQGQLYEVLRAGRPVTP    141 - 210
SLLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITYDDVVKISDFGTSKELSDKSTKMSFAGTVAWMAPE    211 - 280
VIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSAIIWGVGSNSLHLPVPSSCPDGFKILLRQCWNSK    281 - 350
PRNRPSFRQILLHLDIASADVLSTPQETYFKSQAEWREEVKLHFEKIKSEGTCLHRLEEELVMRRREELR    351 - 420
HALDIREHYERKLERANNLYMELNALMLQLELKERELLRREQALERRCPGLLKPHPSRGLLHGNTMEKLI    421 - 490
KKRNVPQKLSPHSKRPDILKTESLLPKLDAALSGVGLPGCPKGPPSPGRSRRGKTRHRKASAKGSCGDLP    491 - 560
GLRTAVPPHEPGGPGSPGGLGGGPSAWEACPPALRGLHHDLLLRKMSSSSPDLLSAALGSRGRGATGGAG    561 - 630
DPGSPPPARGDTPPSEGSAPGSTSPDSPGGAKGEPPPPVGPGEGVGLLGTGREGTSGRGGSRAGSQHLTP    631 - 700
AALLYRAAVTRSQKRGISSEEEEGEVDSEVELTSSQRWPQSLNMRQSLSTFSSENPSDGEEGTASEPSPS    701 - 770
GTPEVGSTNTDERPDERSDDMCSQGSEIPLDPPPSEVIPGPEPSSLPIPHQELLRERGPPNSEDSDCDST    771 - 840
ELDNSNSVDALRPPASLPP                                                       841 - 859
//

Text Mined References (33)

PMID Year Title
25999017 2015 MicroRNA-130a Targets MAP3K12 to Modulate Diabetic Endothelial Progenitor Cell Function.
25341110 2015 Discovery of dual leucine zipper kinase (DLK, MAP3K12) inhibitors with activity in neurodegeneration models.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21893036 2011 Loss of DLK expression in WI-38 human diploid fibroblasts induces a senescent-like proliferation arrest.
21526495 2011 Assessment of the pathway of apoptosis involving PAR-4, DAXX and ZIPK proteins in CLL patients and its relationship with the principal prognostic factors.
19851984 2010 Genetic variation in MicroRNA genes and risk of oral premalignant lesions.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19675578 2010 The small heat-shock protein Hsp27 undergoes ERK-dependent phosphorylation and redistribution to the cytoskeleton in response to dual leucine zipper-bearing kinase expression.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19146952 2009 The mixed-lineage kinase DLK undergoes Src-dependent tyrosine phosphorylation and activation in cells exposed to vanadate or platelet-derived growth factor (PDGF).
18995835 2008 DAPK-ZIPK-L13a axis constitutes a negative-feedback module regulating inflammatory gene expression.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16541075 2006 The finished DNA sequence of human chromosome 12.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15695824 2005 The mitogen-activated protein kinase kinase kinase dual leucine zipper-bearing kinase (DLK) acts as a key regulator of keratinocyte terminal differentiation.
15611134 2005 Regulation of zipper-interacting protein kinase activity in vitro and in vivo by multisite phosphorylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14697235 2004 SP3 acts as a positive regulator on the core promoter of human ZPK gene.
14504284 2003 Akt2 negatively regulates assembly of the POSH-MLK-JNK signaling complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10922377 2000 The mixed lineage kinase DLK is oligomerized by tissue transglutaminase during apoptosis.
10801814 2000 MAPK upstream kinase (MUK)-binding inhibitory protein, a negative regulator of MUK/dual leucine zipper-bearing kinase/leucine zipper protein kinase.
10490457 1999 Localization of the mixed-lineage kinase DLK/MUK/ZPK to the Golgi apparatus in NIH 3T3 cells.
10442638 1999 ZPK inhibits PKA induced transcriptional activation by CREB and blocks retinoic acid induced neuronal differentiation.
10187804 1999 The mixed lineage kinase DLK utilizes MKK7 and not MKK4 as substrate.
9353328 1997 Molecular cloning and functional expression of a cDNA encoding a new member of mixed lineage protein kinase from human brain.
8663324 1996 Characterization of dual leucine zipper-bearing kinase, a mixed lineage kinase present in synaptic terminals whose phosphorylation state is regulated by membrane depolarization via calcineurin.
8637721 1996 Activation of the JNK pathway by distantly related protein kinases, MEKK and MUK.
8037767 1994 Cloning of a novel putative protein kinase having a leucine zipper domain from human brain.
7983011 1994 Identification, molecular cloning, and characterization of dual leucine zipper bearing kinase. A novel serine/threonine protein kinase that defines a second subfamily of mixed lineage kinases.
7790002 1995 Localization of the human zipper protein kinase gene (ZPK) to chromosome 12q13 by fluorescence in situ hybridization and somatic cell hybrid analysis.