Property Summary

Ligand Count 2
NCBI Gene PubMed Count 77
PubMed Score 74.40
PubTator Score 95.33

Knowledge Summary

Patent (18,365)

Expression

  Differential Expression (17)

Disease log2 FC p
Rheumatoid arthritis 1.500 3.1e-02
adult high grade glioma -1.300 1.7e-02
atypical teratoid / rhabdoid tumor 1.400 1.2e-03
Chronic Lymphocytic Leukemia 1.086 6.6e-03
colon cancer -1.400 1.4e-02
diabetes mellitus 1.300 2.8e-03
Endometriosis -1.265 4.4e-02
gastric cancer 1.400 4.6e-03
glioblastoma -1.800 1.9e-04
inflammatory breast cancer -1.600 1.3e-08
lung cancer -1.700 3.1e-02
malignant mesothelioma -1.800 9.4e-06
pancreatic cancer 1.200 3.5e-03
pancreatic carcinoma 1.200 3.5e-03
psoriasis -1.600 5.0e-04
sonic hedgehog group medulloblastoma 1.300 1.0e-06
tuberculosis 2.400 8.8e-08

Protein-protein Interaction (2)

Gene RIF (41)

AA Sequence

MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKM      1 - 70
RHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFY     71 - 140
KQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAK    141 - 210
TIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPA    211 - 280
DKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD                    281 - 334
//

Text Mined References (84)

PMID Year Title