Property Summary

NCBI Gene PubMed Count 56
PubMed Score 59.42
PubTator Score 53.06

Knowledge Summary

Patent (5,337)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.334 9.3e-07
tuberculosis 1.300 4.5e-05
diabetes mellitus -1.300 5.0e-03

Protein-protein Interaction (6)

Gene RIF (30)

PMID Text
26498236 Our findings confirm an association between the BTBD9, MEIS1, and MAP2K5/SKOR1 SNPs and periodic limb movements of sleep in an elderly cohort.
25662172 High MEK5 expression is associated with colorectal cancer.
25637721 SEC16B, MC4R, MAP2K5 and KCTD15 (rs17782313, rs543874, rs2241423 and rs11084753) polymorphisms are associated with the risk for children obesity in China.
25142570 Periodic leg movements during sleep are associated with polymorphisms in BTBD9, TOX3/BC034767, MEIS1, MAP2K5/SKOR1, and PTPRD
24975362 Inhibitors of apoptosis proteins regulate myogenic differentiation by directly suppressing MEKK2/3-MEK5-ERK5 signaling.
24436253 MiR-330-3p and MAP2K5 are potentially important contributors to mood and anxiety-related traits
24205826 Specifically, CKS1B and MAP2K5 significantly inhibited hepatitis C viral RNA replication. PACSIN1, by contrast, inhibited hepatitis C virus infection by decreasing the level of viral protein p7.
23950888 MEK5/ERK5 signaling suppresses estrogen receptor expression and promotes hormone-independent tumorigenesis.
22594783 Single nucleotide polymorphism in the MAP2K5 gene is associated with BMI and obesity.
21925394 Variants in MEIS1, BTBD9, and MAP2K5/SKOR1 confer a significant risk of restless legs syndrome in a United States population.
21861603 data indicate that the rs3743354 polymorphism in the MEK5 promoter may affect the risk of developing colorectal cancer
21820407 These results suggest that MEK5/ERK5 is important for FLT3-ITD induced hematopoietic transformation.
21767578 HCVne particles are capable of inducing the recently discovered ERK5 pathway, in a dose dependent way.
21166929 MEK5 activation by laminar shear stress inhibits inflammatory responses in microvascular endothelial cells, in part through ERK5-dependent induction of KLF4
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20396431 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19822783 Observational study of gene-disease association. (HuGE Navigator)
19605361 MEK5/ERK5 signaling modulates endothelial cell migration and focal contact turnover
19279021 Observational study of gene-disease association. (HuGE Navigator)
19223043 Observational study of gene-disease association. (HuGE Navigator)
18071319 ERK5 nuclear staining has been shown to be an independent marker of prognosis in CaP, and may prove useful as a stratification tool to identify a more aggressive/metastatic phenotype
17872495 Data suggest that HGF-induced effects in some mesothelioma cells are mediated via activation of a novel PI3K/ERK5/Fra-1 feedback pathway
17637780 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16758967 Genistein can affect the ERK5 MAPK signaling transduction pathway and induce the expressions of apoptosis related proteins to inhibit the proliferation of MDA-MB-231 cells.
15378007 MEK5 may be one of the Stat3-regulated genes and plays its essential roles in oncogenesis
15075238 nuclear localization of MEK5 and ERK5 is different from that of ERK1/2 and MEK1/2 in resting cells, indicating that each MAPK cascade uses distinct mechanisms
14583600 alternative splicing of MEK5alpha and MEK5beta may play a critical role in BMK1 activation and subsequent cell proliferation
12618764 MEK5 overexpression is associated with metastatic prostate cancer, and stimulates proliferation, MMP-9 expression and invasion. MEK5 is a key signalling molecule associated with prostate carcinogenesis.
12219026 overexpression of MEK5 in APO- MCF-7 breast carcinoma cells shows that this MAPK signaling protein represents a potent survival molecule.

AA Sequence

MLWLALGPFPAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAFEYEDEDGDRI      1 - 70
TVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGLKVNTRAGPSQHSSPAVSDSL     71 - 140
PSNSLKKSSAELKKILANGQMNEQDIRYRDTLGHGNGGTVYKAYHVPSGKILAVKVILLDITLELQKQIM    141 - 210
SELEILYKCDSSYIIGFYGAFFVENRISICTEFMDGGSLDVYRKMPEHVLGRIAVAVVKGLTYLWSLKIL    211 - 280
HRDVKPSNMLVNTRGQVKLCDFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELA    281 - 350
LGRFPYPQIQKNQGSLMPLQLLQCIVDEDSPVLPVGEFSEPFVHFITQCMRKQPKERPAPEELMGHPFIV    351 - 420
QFNDGNAAVVSMWVCRALEERRSQQGPP                                              421 - 448
//

Text Mined References (60)

PMID Year Title
26498236 2015 Genetic associations of periodic limb movements of sleep in the elderly for the MrOS sleep study.
25662172 2015 SATB2 suppresses the progression of colorectal cancer cells via inactivation of MEK5/ERK5 signaling.
25637721 2015 Genetic variations in SEC16B, MC4R, MAP2K5 and KCTD15 were associated with childhood obesity and interacted with dietary behaviors in Chinese school-age population.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25142570 2014 Periodic leg movements during sleep are associated with polymorphisms in BTBD9, TOX3/BC034767, MEIS1, MAP2K5/SKOR1, and PTPRD.
24975362 2014 Ubiquitin-dependent regulation of MEKK2/3-MEK5-ERK5 signaling module by XIAP and cIAP1.
24861553 2014 Meta-analysis of genome-wide association studies in East Asian-ancestry populations identifies four new loci for body mass index.
24436253 2014 The effects of a MAP2K5 microRNA target site SNP on risk for anxiety and depressive disorders.
24205826 2014 Identification of novel human kinases that suppress hepatitis C virus infection.
23950888 2013 MEK5/ERK5 signaling suppresses estrogen receptor expression and promotes hormone-independent tumorigenesis.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
22594783 2012 The MAP2K5-linked SNP rs2241423 is associated with BMI and obesity in two cohorts of Swedish and Greek children.
22344219 2012 Meta-analysis identifies common variants associated with body mass index in east Asians.
21925394 2011 Association studies of variants in MEIS1, BTBD9, and MAP2K5/SKOR1 with restless legs syndrome in a US population.
21861603 2012 Mitogen/extracellular signal-regulated kinase kinase-5 promoter region polymorphisms affect the risk of sporadic colorectal cancer in a southern Chinese population.
21820407 2011 Inhibition of MEK5 by BIX02188 induces apoptosis in cells expressing the oncogenic mutant FLT3-ITD.
21779176 2011 Genome-wide association study identifies novel restless legs syndrome susceptibility loci on 2p14 and 16q12.1.
21767578 2011 MEK5/ERK5/mef2: a novel signaling pathway affected by hepatitis C virus non-enveloped capsid-like particles.
21166929 2011 MEK5 is activated by shear stress, activates ERK5 and induces KLF4 to modulate TNF responses in human dermal microvascular endothelial cells.
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20551324 2010 Erk5 activation elicits a vasoprotective endothelial phenotype via induction of Kruppel-like factor 4 (KLF4).
20396431 2010 Genotyping sleep disorders patients.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19822783 2009 Association of intronic variants of the BTBD9 gene with Tourette syndrome.
19605361 2009 MEK5/ERK5 signaling modulates endothelial cell migration and focal contact turnover.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19279021 2009 Replication of restless legs syndrome loci in three European populations.
19223043 2009 Exploring the genetic link between RLS and ADHD.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18588859 2008 TGF-beta activates ERK5 in human renal epithelial cells.
18071319 2008 Aberrant expression of extracellular signal-regulated kinase 5 in human prostate cancer.
17872495 2008 HGF mediates cell proliferation of human mesothelioma cells through a PI3K/MEK5/Fra-1 pathway.
17637780 2007 Genome-wide association study of restless legs syndrome identifies common variants in three genomic regions.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16758967 2006 [Effects of ERK5 MAPK signaling transduction pathway on the inhibition of genistein to breast cancer cells].
16728640 2006 Yersinia YopJ acetylates and inhibits kinase activation by blocking phosphorylation.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15378007 2004 Stat3 upregulates MEK5 expression in human breast cancer cells.
15075238 2004 MEK5 and ERK5 are localized in the nuclei of resting as well as stimulated cells, while MEKK2 translocates from the cytosol to the nucleus upon stimulation.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14583600 2004 Differential role of MEK5alpha and MEK5beta in BMK1/ERK5 activation.
12618764 2003 MEK5 overexpression is associated with metastatic prostate cancer, and stimulates proliferation, MMP-9 expression and invasion.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12219026 2002 Identification of mitogen-activated protein kinase kinase as a chemoresistant pathway in MCF-7 cells by using gene expression microarray.
11520859 2001 Extracellular signal regulated kinase 5 (ERK5) is required for the differentiation of muscle cells.
11387209 2001 Activated MEK5 induces serial assembly of sarcomeres and eccentric cardiac hypertrophy.
11158308 2001 MEK5, a new target of the atypical protein kinase C isoforms in mitogenic signaling.
11073940 2001 MEKK2 associates with the adapter protein Lad/RIBP and regulates the MEK5-BMK1/ERK5 pathway.
10593883 1999 MEKK3 directly regulates MEK5 activity as part of the big mitogen-activated protein kinase 1 (BMK1) signaling pathway.
10531364 1999 Contribution of the ERK5/MEK5 pathway to Ras/Raf signaling and growth control.
9790194 1998 Bmk1/Erk5 is required for cell proliferation induced by epidermal growth factor.
9384584 1997 BMK1/ERK5 regulates serum-induced early gene expression through transcription factor MEF2C.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7759517 1995 Components of a new human protein kinase signal transduction pathway.
7499418 1995 Isolation of MEK5 and differential expression of alternatively spliced forms.