Property Summary

NCBI Gene PubMed Count 19
PubMed Score 34.58
PubTator Score 22.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 7.9e-05
osteosarcoma 7933 1.4e-03
Gaucher disease type 1 171 2.7e-02
spina bifida 1064 3.5e-02
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.098 1.4e-03
spina bifida 1.185 3.5e-02
ovarian cancer 1.200 7.9e-05
Gaucher disease type 1 1.100 2.7e-02

Gene RIF (12)

PMID Text
26540094 HDAC4 destabilizes MAP1S, suppresses autophagy flux and promotes the accumulation of mHTT aggregates.
25505242 results support a role for MAP1 proteins in promoting efficient retrograde trafficking of HIV-1 by stimulating the formation of stable microtubules and mediating the association of HIV-1 cores with microtubules.
25505242 MAP1A and MAP1S proteins activate HIV-1 retrograde trafficking by tethering capsids to microtubules in primary human macrophages
25505242 Knockdown of MAP1S by shRNA inhibits HIV-1 infectivity in human PBMCs
25300793 Ddata underline the key role of MAP1S as a global regulator of microbutule stability and demonstrate a new primary function of MAP1S to regulate MT dynamics at the onset of cytokinesis.
25043887 The PU.1-regulated MAP1S gene is implicated in neutrophil differentiation and autophagy control.
21262964 clarify roles of MAP1S in bridging microtubules and mitochondria with autophagic and mitophagic initiation, maturation, trafficking, and lysosomal clearance.
19759419 C19ORF5 distributed broadly across the mitotic spindle and reversibly accumulated during reversible mitotic arrest.
19027008 These results suggest that the interaction of SOCS3 with MAP1S and the integrity of the microtubule cytoskeleton play an important role in the negative regulation of SOCS3 on IL-6 signaling.
15907802 Deletion mutagenesis indicated that C19ORF5 selectively binds double stranded DNA through its microtubule binding domain.
15528209 is expressed in a wide range of tissues in addition to neurons and represents the non-neuronal counterpart of a cytolinker family
14627543 The amino acid sequence of VCY2IP-1 shows 59.3% and 41.9% homology to two human microtubule-associated proteins (MAPs), MAP1B and MAP1A, respectively. VCY2IP-1 has an extensive homology to the N-terminus and C-terminus regions of MAP1B and MAP1A

AA Sequence

MAAVAGSGAAAAPSSLLLVVGSEFGSPGLLTYVLEELERGIRSWDVDPGVCNLDEQLKVFVSRHSATFSS      1 - 70
IVKGQRSLHHRGDNLETLVLLNPSDKSLYDELRNLLLDPASHKLLVLAGPCLEETGELLLQTGGFSPHHF     71 - 140
LQVLKDREIRDILATTPPPVQPPILTITCPTFGDWAQLAPAVPGLQGALRLQLRLNPPAQLPNSEGLCEF    141 - 210
LEYVAESLEPPSPFELLEPPTSGGFLRLGRPCCYIFPGGLGDAAFFAVNGFTVLVNGGSNPKSSFWKLVR    211 - 280
HLDRVDAVLVTHPGADSLPGLNSLLRRKLAERSEVAAGGGSWDDRLRRLISPNLGVVFFNACEAASRLAR    281 - 350
GEDEAELALSLLAQLGITPLPLSRGPVPAKPTVLFEKMGVGRLDMYVLHPPSAGAERTLASVCALLVWHP    351 - 420
AGPGEKVVRVLFPGCTPPACLLDGLVRLQHLRFLREPVVTPQDLEGPGRAESKESVGSRDSSKREGLLAT    421 - 490
HPRPGQERPGVARKEPARAEAPRKTEKEAKTPRELKKDPKPSVSRTQPREVRRAASSVPNLKKTNAQAAP    491 - 560
KPRKAPSTSHSGFPPVANGPRSPPSLRCGEASPPSAACGSPASQLVATPSLELGPIPAGEEKALELPLAA    561 - 630
SSIPRPRTPSPESHRSPAEGSERLSLSPLRGGEAGPDASPTVTTPTVTTPSLPAEVGSPHSTEVDESLSV    631 - 700
SFEQVLPPSAPTSEAGLSLPLRGPRARRSASPHDVDLCLVSPCEFEHRKAVPMAPAPASPGSSNDSSARS    701 - 770
QERAGGLGAEETPPTSVSESLPTLSDSDPVPLAPGAADSDEDTEGFGVPRHDPLPDPLKVPPPLPDPSSI    771 - 840
CMVDPEMLPPKTARQTENVSRTRKPLARPNSRAAAPKATPVAAAKTKGLAGGDRASRPLSARSEPSEKGG    841 - 910
RAPLSRKSSTPKTATRGPSGSASSRPGVSATPPKSPVYLDLAYLPSGSSAHLVDEEFFQRVRALCYVISG    911 - 980
QDQRKEEGMRAVLDALLASKQHWDRDLQVTLIPTFDSVAMHTWYAETHARHQALGITVLGSNSMVSMQDD    981 - 1050
AFPACKVEF                                                                1051 - 1059
//

Text Mined References (40)

PMID Year Title
26540094 2015 Blocking the association of HDAC4 with MAP1S accelerates autophagy clearance of mutant Huntingtin.
25505242 2015 Microtubule-associated proteins 1 (MAP1) promote human immunodeficiency virus type I (HIV-1) intracytoplasmic routing to the nucleus.
25300793 2014 MAP1S controls microtubule stability throughout the cell cycle in human cells.
25043887 2014 Induction of the autophagy-associated gene MAP1S via PU.1 supports APL differentiation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22523538 2012 Nemitin, a novel Map8/Map1s interacting protein with Wd40 repeats.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21262964 2011 Microtubule-associated protein 1S (MAP1S) bridges autophagic components with microtubules and mitochondria to affect autophagosomal biogenesis and degradation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19759419 2009 Dual function microtubule- and mitochondria-associated proteins mediate mitotic cell death.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19027008 2008 The role of microtubule-associated protein 1S in SOCS3 regulation of IL-6 signaling.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18419581 2008 MAP1 structural organization in Drosophila: in vivo analysis of FUTSCH reveals heavy- and light-chain subunits generated by proteolytic processing at a conserved cleavage site.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17658481 2007 The NMDAR subunit NR3A interacts with microtubule-associated protein 1S in the brain.
17234756 2007 Depletion of the Ras association domain family 1, isoform A-associated novel microtubule-associated protein, C19ORF5/MAP1S, causes mitotic abnormalities.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16396496 2006 Insulin-dependent interactions of proteins with GLUT4 revealed through stable isotope labeling by amino acids in cell culture (SILAC).
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16297881 2006 Microtubule-associated protein 8 contains two microtubule binding sites.
15907802 2005 Putative tumor suppressor RASSF1 interactive protein and cell death inducer C19ORF5 is a DNA binding protein.
15899810 2005 Distinct structural domains within C19ORF5 support association with stabilized microtubules and mitochondrial aggregation and genome destruction.
15753381 2005 Specificity of the methylation-suppressed A isoform of candidate tumor suppressor RASSF1 for microtubule hyperstabilization is determined by cell death inducer C19ORF5.
15528209 2005 Microtubule-associated protein 1S, a short and ubiquitously expressed member of the microtubule-associated protein 1 family.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15205320 2004 RASSF1A interacts with microtubule-associated proteins and modulates microtubule dynamics.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14627543 2004 Identification and characterization of human VCY2-interacting protein: VCY2IP-1, a microtubule-associated protein-like protein.
12762840 Novel complex integrating mitochondria and the microtubular cytoskeleton with chromosome remodeling and tumor suppressor RASSF1 deduced by in silico homology analysis, interaction cloning in yeast, and colocalization in cultured cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11827465 2002 Sequence analysis of LRPPRC and its SEC1 domain interaction partners suggests roles in cytoskeletal organization, vesicular trafficking, nucleocytosolic shuttling, and chromosome activity.