Property Summary

NCBI Gene PubMed Count 142
PubMed Score 119.77
PubTator Score 575.10

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -2.000 4.0e-03
ependymoma -1.500 1.6e-02
oligodendroglioma -1.500 3.3e-03
glioblastoma -1.300 8.3e-08
medulloblastoma, large-cell -1.400 2.0e-03
primitive neuroectodermal tumor -1.300 6.1e-03
adult high grade glioma -1.500 5.9e-05
subependymal giant cell astrocytoma -1.389 3.5e-02
lung carcinoma 1.100 2.0e-22
Pick disease -1.500 3.3e-06

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
463193 screening 1904 / 52 / 192541 High-content cell-based screening for modulators of autophagy

Gene RIF (115)

PMID Text
26722036 Autophagy status, as determined by combined LC3, Beclin 1 and p62 expression, might be independently associated with poor survival in patients with gastric cancer.
26676801 Consistent with the in vitro results, we observed that the expression of autophagy marker LC3 was increased.
26468287 FYCO1 requires a functional LC3A/B-preferring LC3-interacting Region (LIR) motif to facilitate efficient maturation of autophagosomes under basal conditions, whereas starvation-induced autophagy was unaffected
26395023 up-regulated expression during the monocyte-to-dendritic cell transition
26350055 Up-regulation of LC3 is associated with carcinogenesis and progression of Salivary Adenoid Cystic Carcinoma.
26330555 HIV-1 Env gp120 treatment of SH-SY5Y cells increases MAP1LC3A (LC3-II, membrane-associated lipidated form) which indicates induction of autophagy
26150155 Western blot and immunofluorescence validated antibody specificity, knockdown efficiency and autophagy induction prior to fixation in formalin and embedding in paraffin. LC3B and p62 antibodies were validated on cell pellets
26097572 In colorectal cancer, differentiation degree and lymph node metastasis were associated with LC3 overexpression. LC3 expression was significantly higher in cancerous tissue than in adjacent tissue.
26090585 LC3 is exploited by coxsackievirus in both autophagy-dependent and -independent manners in vivo
26084608 high nuclear HMGB1 levels and cytoplasmic HMGB1 expression predicted poor overall survival (OS) and disease-free survival (DFS). Meanwhile, high LC3 expression was associated with favorable prognosis.
26015503 The authors show that LC3 is recruited specifically around secreting Shigella flexneri bacteria that are still present in vacuoles formed during entry and cell-to-cell spread.
25955014 These results demonstrate the essential role of BECN1 in the functional formation of autophagosomes, but not in LC3B lipidation.
25871810 Patients with strong immunoreactivity to BECLIN 1 or LC3 had a significantly better overall survival (OS) than patients with negative to moderate immunoreactivity (p = 0.036 and 0.018, respectively).
25847297 HIV-1 Env gp120 treatment of SH-SY5Y cells increases MAP1LC3A (LC3-II, membrane-associated lipidated form) which indicates induction of autophagy
25824726 Downregulation of beta 3 -integrin with cRGD peptide resulted in enhanced LC3-II and Beclin-1 and decreased Bcl-2 expression.
25661375 This study aimed to explore autophagy-related protein light chain 3 (LC3)-II expression levels in thyroid diseases.
25601754 Results show that acetylation-deacetylation cycle ensures that LC3 effectively redistributes in an activated form from nucleus to cytoplasm, where it plays a central role in autophagy.
25503391 Clusterin facilitates stress-induced lipidation of LC3 and autophagosome biogenesis to enhance cancer cell survival.
25498145 PLEKHM1 regulates autophagosome-lysosome fusion through homotypic fusion and protein sorting complex and LC3/GABARAP proteins.
25490467 HIV-1 Env gp120 treatment of SH-SY5Y cells increases MAP1LC3A (LC3-II, membrane-associated lipidated form) which indicates induction of autophagy
25484071 These data add novel mechanistic insights into the regulation of noncanonical LC3 lipidation and its associated processes, including LC3-associated phagocytosis.
25483962 CHDH is required for PARK2-mediated mitophagy for the recruitment of SQSTM1 and LC3 onto the mitochondria for cargo recognition
25466963 LC3, beclin-1, and p62, was increased at an early stage of multistep cholangiocarcinogenesis in hepatolithiasis
25419843 Data show that interaction between promyelocytic leukemia protein (PML) and microtubule-associated protein light chain 3 (LC3) contributes to cell growth inhibition function of PML.
25416948 HIV-1 Env gp120 treatment of SH-SY5Y cells increases MAP1LC3A (LC3-II, membrane-associated lipidated form) which indicates induction of autophagy
25311841 PLP2-TM interacts with the key autophagy regulators, LC3 and Beclin1, and promotes Beclin1 interaction with STING, the key regulator for antiviral IFN signaling, to negatively regulate antiviral innate immunity.
25136588 high level of expression of BECLIN 1 and LC3 in tumours is well correlated with the overall survival of the patients.
25132643 caspase-8 and LC3 are ubiquinated and have roles in 2',3'-dimethoxyflavanone-induced apoptosis in breast cancer stem cells
25046114 highlight the role that VAMP3 and VAMP7 play in selection of the pathways leading to generation of ultrastructurally different LC3 compartments
25005847 A significant association of LC3 expression with disease progression including a large tumor size, higher stage, and worse prognosis of hepatocellular carcinoma.
24899049 The results revealed that the expression of Atg12 and LC3 II/LC3 I in the chondrocytes treated with TXC increased, compared to that in the untreated chondrocytes
24886140 In all NHD brains, Nogo-A-positive, CNPase-positive oligodendrocytes surviving in the non-demyelinated white matter intensely expressed LC3
24806912 direct association with LC3 and p62 is promoted in osteoblasts by bioactive silica nanoparticles
24690104 investigated the expression of autophagy-related markers microtubule-associated protein IA/IB light chain 3 (LC3) and p62/sequestosome-1 (p62), in cutaneous squamous cell carcinoma specimens and assessed their correlation to clinicopathological factors
24532538 High LC3A expression is associated with gastric cancer.
24528869 Authors show that the cytoplasmic tail of influenza A virus M2 interacts directly with the essential autophagy protein LC3 and promotes LC3 relocalization to the unexpected destination of the plasma membrane.
24440703 Data indicate that rapamycin significantly enhanced mitophagy, as evidenced by the increase in LC3-II and Beclin-1 expression in the mitochondria and p62 translocation to the mitochondria.
24404161 HRES-1/Rab4 regulates autophagy through promoting the formation of LC3(+) autophagosomes and the preservation of mitochondria.
24290141 Specific affinity of the LC3 isoforms to the Atg13 LC3-interacting region is required for proper autophagosome formation.
24282606 results suggest that the expression and extent of LC3 might be a strong prognostic factor of HCC, especially in patients with surgical resection
24186908 Low level of LC3-II indicates poor prognosis of renal clear cell carcinoma.
24070620 Data suggest that expression of LC3 and autophagy are up-regulated in placenta from pregnancy in which newborn infant develops severe acidosis/neonatal encephalopathy; thus, placental LC3 expression is potential biomarker for poor neonatal outcome.
24067654 AP-2/PICALM complex functions as an autophagic cargo receptor for the recognition and shipment of APP-CTF from the endocytic pathway to the LC3-marked autophagic degradation pathway.
24023838 a protective mechanism for Atg4B, Atg3 and LC3-Atg3 conjugate from being inappropriately sequestered into p62 aggregates
23956998 We found no relationship between LC3-II expression and any of the clinical parameters (time to vaginal delivery and maternal and fetal characteristics) with the exception of pre-pregnancy BMI: as BMI increased, placental autophagy expression decreased
23787295 Data indicate that high cytoplasmic microtubule-associated protein 1 light chain LC3A, LC3B, Beclin 1 and p62/SQSTM1 expressions were independently linked with the Gleason score.
23752596 MAP1LC3 and p62/SQSTM1 proteins are the most common markers of the autophagy process.
23681079 LC3 and p62 are diagnostic markers of drug-induced autophagic vacuolar cardiomyopathy.
23632916 Thus, p53 and LC3A co-expression is an independent prognostic marker for patients with ESCC.
23624503 Data indicate that autophagy is activated though the Cdx1-Bcl-2-LC3 pathway.
23449484 Increased expression of SFRP-1 and LC3 was observed in keratoconus corneas.
23376921 TMEM59 defines a novel ATG16L1-binding motif that promotes local activation of LC3.
23345115 Our results suggested that expression of LC3 in triple-negative breast cancer was associated with higher distant metastases
23333394 these data provide compelling evidence that "stone-like" expression of LC3A plays an important role in HCC progression and may act as a biomarker of prognosis for patients with HCC.
23219390 DNA-immune complexes recruit TLR9 and autophagy protein LC3 to phagosomes through Fc-gamma receptor signaling. LC3-associated phagocytosis (LAP), which is distinct from conventional autophagy, is required for IFN-alpha secretion but not for TLR9-mediated TNF secretion. LAP mediates trafficking of TLR9 into a specialized IFN-signaling compartment that initiates IFN-alpha production.
23209295 pro-survival Bcl-x(L) positively regulated Bnip3 binding to LC3B, sequestration, and mitochondrial autophagy, further supporting an anti-apoptotic role for Bnip3-induced mitophagy
23089287 LC3, beclin 1, and GRP78 may play an important role in the tumorigenesis of adenoid cystic carcinoma.
22974335 Immunoblotting demonstrated a marked reduction of LC3 in tuberous sclerosis complex tubers relative to the controls
22959883 Results showed that detergent-insoluble LC3-I and -II levels were significantly higher in multiple system atrophy brain tissue than those in controls
22728060 Autophagy-related LC3 protein is not involved in the formation/degradation of neuronal intranuclear inclusions in neurodegenerative diseases.
22648564 expression level of both Beclin-1 and LC3 were significantly lower in cervical squamous cancer cells than normal squamous epithelial cells.
22647537 Detection of LC3 puncta in human formalin-fixed, paraffin-embedded cancer specimens, is reported.
22505714 Bnip3 induced removal of both ER (ERphagy) and mitochondria (mitophagy) via autophagy. The clearance of these organelles was mediated in part via binding of Bnip3 to LC3 on the autophagosome.
22421968 cell death observed after TP53INP1-LC3 interaction depends on both autophagy and caspase activity.
22328508 The LC3 associated with and then budded off from a distinct TGN domain without constitutive TGN-to-plasma cargo and TGN-to-endosome proteins.
22281431 Data indicate that the LC3A was detected as diffuse cytoplasmic staining, and as dense, spheroidal, "stone-like" structures (SLS) of variable size (1.2-12.0 mum in diameter), typically enclosed within cytoplasmic vacuoles.
22249245 These results suggest that LC3Av1, not only LC3B, functions in autophagy and further, LC3Av1 may be crucial in carcinogenesis.
22237724 The results suggested that the biosynthesis of microtubule-associated protein 1 light chain 3 is interrupted in hypertrophic scars.
22011618 LC3-structure nucleates at sites on Parkin-labeled mitochondria, showing a role in mediating mitophagy
21943220 Ceramide could induce autophagy in human nasopharyngeal carcinoma cells, and activation of JNK pathway was involved in ceramide-induced autophagy and LC3 expression.
21845828 Expression of microtuble-associated protein 1 light chain 3 is down-regulated in laryngeal squamous cell carcinoma.
21812771 LC3 gene expression in the peripheral leucocytes was significantly decreased in patients with coronary artery disease, indicating that autophagosome formation is decreased.
21729531 Up-regulation of autophagic activity and expression of Beclin1 and MAPLC3 mRNA in refractory or relapse acute leukemia patients is especially significant.
21709020 Data show that luminal P-PERK and LC3 levels are reduced in PERK-deficient mammary glands, whereas they are increased in human breast ductal carcinoma in situ.
21684337 Biochemical and pathological properties of LC3 are altered; the level of LC3 is increased in an insoluble fraction from the brains of patients with Lewy body disease.
21674156 All cases of granular cell tumor (GCT) showed granule LC3 in cytoplasm of tumor cells, indicating that formation of intracytoplasmic granules in GCT is closely related to autophagy. In schwannoma small number of tumor cells showed granule LC3.
21628531 inhibition of proteasomal degradation results in increased oligomerization and activation of caspase-8 on intracellular membranes; enhanced caspase-8 oligomerization and activation are promoted through interaction with SQSTM1/p62 and (LC3)
21556768 Both mRNA and protein levels of Beclin-1 and LC3-II were significantly decreased in lung cancer tissues which suggested that autophagy may be involved in the pathogenesis of lung cancer.
21537144 Low LC3A expression was related to ulceration, but not to other histopathological features nor prognosis in cutaneous melanoma.
21507968 SHBs (HBV small surface protein) partially colocalized and interacted with autophagy protein LC3.
21497758 The fusion activity of LC3 is mediated by positively charged amino acids, whereas the activity of GATE-16 is mediated by hydrophobic interactions.
21415575 Data show that the expression of LC3, rather than beclin-1, was strongly associated with metastasis and poor clinical prognosis of human melanoma.
21412173 Immunoblot analysis demonstrated specific accumulation of the autophagosomal LC3-II isoform in detergent-insoluble fractions from Lewy body disease brains
21316776 LC3 regulates cardiomyocyte autophagy by hypoxia-reoxygenation.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
21045561 p62 can be efficiently localized to autophagic compartments via preferential binding with LC3-II form.
20937856 In HCT116 colorectal cancer cells exposed to prolonged nutrient deprivation, the endogenous wt p53 posttranscriptionally down-regulates LC3, a pivotal component of the autophagic machinery.
20713600 These data demonstrate a role for phosphorylation in regulating LC3 activity.
20639871 Binding of Dvl2 to p62 facilitates the aggregation and the LC3-mediated autophagosome recruitment of Dvl2 under starvation; the ubiquitylated Dvl2 aggregates are ultimately degraded through the autophagy-lysosome pathway.
20505359 A role for WIPI2 in the progression of omegasomes into autophagosomes, is reported.
20479004 Pin1 induces LC-3 expression and mediates tamoxifen resistance in breast cancer
20398630 PKC regulates autophagy through a mechanism independent of LC3 phosphorylation.
20382705 LC3A is expressed in operable breast carcinomas
20352102 analysis of nucleocytoplasmic distribution and dynamics of the autophagosome marker EGFP-LC3
20061800 Processing of autophagic protein LC3 by the 20S proteasome.
20023420 The presence of LC3 in cytoplasmic puncta does not necessarily reveal their participation in the formation of phagophores or their accumulation on the membranes from autophagosomes.
20004946 beclin 1 and LC3 II autophagic gene expression is altered also in melanocytic neoplasms.
19812190 A hint for an autophagic fusion event is given by the autophagosome marker green fluorescent protein(GFP)-LC3 that first localizes to autophagic vesicles and then redistributes to Yersinia-containing phagosomes.
19696020 Data suggest that LC3 binding maintains AKAP-Lbc in an inactive state that displays a reduced ability to promote downstream signaling.
19623642 A large number of MAP1LC3A and MAP1LC3B positive breast cancer tissues cores have high proportion of stained cells (81-100%) as compared with normal breast tissues.
19492063 HIV-1 Env gp120 treatment of SH-SY5Y cells increases MAP1LC3A (LC3-II, membrane-associated lipidated form) which indicates induction of autophagy
19322194 The crystal structures of catalytically inert human Atg4B in complex with processed and unprocessed forms of LC3 showed that, on LC3 binding, the regulatory loop and the N-terminal tail of HsAtg4B undergo large conformational changes.
18695874 LC3 is upregulated in various gastrointestinal cancers and partly associated with Ki-67 inde; results suggest that LC3 expression is advantageous to cancer development especially in early-phase carcinogenesis
18688877 The suppression of unfolded protein response or the suppression of expression of LC3 or Atg7, a protein that mediates LC3 lipidation, suppressed HCV replication.
18653543 LC3 is responsible for recruiting p62 into autophagosomes, a process mediated by phenylalanine 52, located within the ubiquitin core, and the N-terminal region of the protein.
17804493 Modification of LC3 occurs both during poliovirus infection and following expression of a single viral protein, a stable precursor termed 2BC.
17580304 The specific interaction between p62 and LC3, mediated by a 22-residue sequence of p62 containing an evolutionarily conserved motif, is instrumental in mediating autophagic degradation of the p62-positive bodies.
17438365 Muscle fibers of patients with inclusion body myositis show increased frequencies of Atg8/LC3(+) autophagosomes and that intracellular amyloid beta-protein colocalized with Atg8/LC3 in degenerating muscle fibers.
17102583 LC3 residues Phe80 and Leu82, the equivalents of Phe77 and Phe79 in Atg8, are essential for its C-terminal cleavage.
16303767 Phosphatidylserine and phosphatidylethanolamine are targets of the mammalian Atg8 modifiers, LC3, GABARAP, and GATE-16
15857831 MAP-LC3 can act as an adaptor protein between microtubules and autophagosomes
15213446 NMR structure of human microtubule-associated protein light chain-3
15187094 localization of LC3 to a membrane compartment by delipidation is negatively regulated by HsAtg4B
8997639 HIV-1 Env gp120 treatment of SH-SY5Y cells increases MAP1LC3A (LC3-II, membrane-associated lipidated form) which indicates induction of autophagy
2212989 HIV-1 Env gp120 treatment of SH-SY5Y cells increases MAP1LC3A (LC3-II, membrane-associated lipidated form) which indicates induction of autophagy

AA Sequence

MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRR      1 - 70
LQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF                        71 - 121
//

Text Mined References (147)

PMID Year Title
26722036 2016 Clinicopathological Correlations of Autophagy-related Proteins LC3, Beclin 1 and p62 in Gastric Cancer.
26676801 2016 Selenite-induced autophagy antagonizes apoptosis in colorectal cancer cells in vitro and in vivo.
26468287 2015 FYCO1 Contains a C-terminally Extended, LC3A/B-preferring LC3-interacting Region (LIR) Motif Required for Efficient Maturation of Autophagosomes during Basal Autophagy.
26395023 2015 IL-10 restricts dendritic cell (DC) growth at the monocyte-to-monocyte-derived DC interface by disrupting anti-apoptotic and cytoprotective autophagic molecular machinery.
26350055 2016 Expression of LC3, LAMP2, KEAP1 and NRF2 in Salivary Adenoid Cystic Carcinoma.
26347139 2015 TRIM-mediated precision autophagy targets cytoplasmic regulators of innate immunity.
26150155 2015 Reliable LC3 and p62 autophagy marker detection in formalin fixed paraffin embedded human tissue by immunohistochemistry.
26097572 2015 Expression and clinical significances of Beclin1, LC3 and mTOR in colorectal cancer.
26090585 2015 Coxsackievirus can exploit LC3 in both autophagy-dependent and -independent manners in vivo.
26084608 2015 HMGB1 overexpression correlates with poor prognosis in early-stage squamous cervical cancer.
26040720 2015 Regulation of endoplasmic reticulum turnover by selective autophagy.
26015503 2015 Escape of Actively Secreting Shigella flexneri from ATG8/LC3-Positive Vacuoles Formed during Cell-To-Cell Spread Is Facilitated by IcsB and VirA.
25955014 2015 Divergent roles of BECN1 in LC3 lipidation and autophagosomal function.
25871810 2015 Autophagic Markers BECLIN 1 and LC3 are Associated with Prognosis of Multiple Myeloma.
25824726 2015 ß3-integrin inhibits lipopolysaccharide-induced autophagy in cardiomyocytes via the Akt signaling pathway.
25689150 2015 Autophagy modulates the effects of bis-anthracycline WP631 on p53-deficient prostate cancer cells.
25661375 2015 Study of autophagy-related protein light chain 3 (LC3)-II expression levels in thyroid diseases.
25601754 2015 Deacetylation of nuclear LC3 drives autophagy initiation under starvation.
25503391 2014 Clusterin facilitates stress-induced lipidation of LC3 and autophagosome biogenesis to enhance cancer cell survival.
25498145 2015 PLEKHM1 regulates autophagosome-lysosome fusion through HOPS complex and LC3/GABARAP proteins.
25484071 2015 V-ATPase and osmotic imbalances activate endolysosomal LC3 lipidation.
25483962 2014 Choline dehydrogenase interacts with SQSTM1/p62 to recruit LC3 and stimulate mitophagy.
25466963 2015 Autophagy may occur at an early stage of cholangiocarcinogenesis via biliary intraepithelial neoplasia.
25419843 2014 Microtubule-associated protein 1 light chain 3 interacts with and contributes to growth inhibiting effect of PML.
25416956 2014 A proteome-scale map of the human interactome network.
25327288 2014 Selective VPS34 inhibitor blocks autophagy and uncovers a role for NCOA4 in ferritin degradation and iron homeostasis in vivo.
25311841 2014 Coronavirus membrane-associated papain-like proteases induce autophagy through interacting with Beclin1 to negatively regulate antiviral innate immunity.
25136588 2014 Expression and clinical significance of the autophagy proteins BECLIN 1 and LC3 in ovarian cancer.
25132643 2014 Mechanism of 2',3'-dimethoxyflavanone-induced apoptosis in breast cancer stem cells: role of ubiquitination of caspase-8 and LC3.
25127057 2014 TRIM proteins regulate autophagy and can target autophagic substrates by direct recognition.
25046114 2014 Role of VAMP3 and VAMP7 in the commitment of Yersinia pseudotuberculosis to LC3-associated pathways involving single- or double-membrane vacuoles.
25042851 2014 Autophagic clearance of polyQ proteins mediated by ubiquitin-Atg8 adaptors of the conserved CUET protein family.
25005847 2014 Clinical significance of autophagic protein LC3 levels and its correlation with XIAP expression in hepatocellular carcinoma.
24899049 2014 Tougu Xiaotong capsule promotes chondrocyte autophagy by regulating the Atg12/LC3 conjugation systems.
24886140 2014 LC3, an autophagosome marker, is expressed on oligodendrocytes in Nasu-Hakola disease brains.
24806912 2014 Bioactive silica nanoparticles promote osteoblast differentiation through stimulation of autophagy and direct association with LC3 and p62.
24690104 2014 Inverse correlation between microtubule-associated protein 1A/1B-light chain 3 and p62/sequestosome-1 expression in the progression of cutaneous squamous cell carcinoma.
24532538 2014 LC3A-positive "stone-like" structures predict an adverse prognosis of gastric cancer.
24528869 2014 A LC3-interacting motif in the influenza A virus M2 protein is required to subvert autophagy and maintain virion stability.
24440703 2014 Rapamycin attenuates mitochondrial dysfunction via activation of mitophagy in experimental ischemic stroke.
24404161 2014 HRES-1/Rab4 promotes the formation of LC3(+) autophagosomes and the accumulation of mitochondria during autophagy.
24290141 2014 Structural basis of the autophagy-related LC3/Atg13 LIR complex: recognition and interaction mechanism.
24282606 2013 The autophagy-related marker LC3 can predict prognosis in human hepatocellular carcinoma.
24186908 2013 Lower mRNA and protein expression levels of LC3 and Beclin1, markers of autophagy, were correlated with progression of renal clear cell carcinoma.
24070620 2013 Autophagy in placentas from acidotic newborns: an immunohistochemical study of LC3 expression.
24067654 2013 Adaptor complex AP2/PICALM, through interaction with LC3, targets Alzheimer's APP-CTF for terminal degradation via autophagy.
24023838 2013 E1-like activating enzyme Atg7 is preferentially sequestered into p62 aggregates via its interaction with LC3-I.
23956998 2013 Autophagy and human parturition: evaluation of LC3 expression in placenta from spontaneous or medically induced onset of labor.
23787295 2014 Autophagy proteins in prostate cancer: relation with anaerobic metabolism and Gleason score.
23752596 2013 [Detection of autophagy based on conversions of MAP1LC3 and p62/SQSTM1].
23681079 2013 LC3 and p62 as diagnostic markers of drug-induced autophagic vacuolar cardiomyopathy: a study of 3 cases.
23632916 2013 High p53 and MAP1 light chain 3A co-expression predicts poor prognosis in patients with esophageal squamous cell carcinoma.
23624503 2013 Autophagy of cancer stem cells is involved with chemoresistance of colon cancer cells.
23459205 2013 Ubiquilin4 is an adaptor protein that recruits Ubiquilin1 to the autophagy machinery.
23449484 2013 Increased expression of secreted frizzled-related protein-1 and microtubule-associated protein light chain 3 in keratoconus.
23376921 2013 TMEM59 defines a novel ATG16L1-binding motif that promotes local activation of LC3.
23345115 2013 Decreased expression of light chain 3 (LC3) increased the risk of distant metastasis in triple-negative breast cancer.
23333394 2013 The "stone-like" pattern of LC3A expression and its clinicopathologic significance in hepatocellular carcinoma.
23219390 2012 Noncanonical autophagy is required for type I interferon secretion in response to DNA-immune complexes.
23209295 2013 Modulation of serines 17 and 24 in the LC3-interacting region of Bnip3 determines pro-survival mitophagy versus apoptosis.
23112293 2012 The Legionella effector RavZ inhibits host autophagy through irreversible Atg8 deconjugation.
23089287 2012 Expression of autophagy and ER stress-related proteins in primary salivary adenoid cystic carcinoma.
23043107 2012 ATG8 family proteins act as scaffolds for assembly of the ULK complex: sequence requirements for LC3-interacting region (LIR) motifs.
22974335 2013 Suppressed expression of autophagosomal protein LC3 in cortical tubers of tuberous sclerosis complex.
22959883 2013 Alteration of autophagosomal proteins in the brain of multiple system atrophy.
22728060 2012 Autophagy-related proteins (p62, NBR1 and LC3) in intranuclear inclusions in neurodegenerative diseases.
22648564 2012 Expression of Beclin 1 and LC3 in FIGO stage I-II cervical squamous cell carcinoma and relationship to survival.
22647537 2012 Immunohistochemical detection of cytoplasmic LC3 puncta in human cancer specimens.
22505714 2012 Microtubule-associated protein 1 light chain 3 (LC3) interacts with Bnip3 protein to selectively remove endoplasmic reticulum and mitochondria via autophagy.
22470510 2012 DOR/Tp53inp2 and Tp53inp1 constitute a metazoan gene family encoding dual regulators of autophagy and transcription.
22456507 2012 Dynamic and transient interactions of Atg9 with autophagosomes, but not membrane integration, are required for autophagy.
22421968 2012 TP53INP1, a tumor suppressor, interacts with LC3 and ATG8-family proteins through the LC3-interacting region (LIR) and promotes autophagy-dependent cell death.
22354992 2012 Rab GTPase-activating proteins in autophagy: regulation of endocytic and autophagy pathways by direct binding to human ATG8 modifiers.
22328508 2012 AP1 is essential for generation of autophagosomes from the trans-Golgi network.
22281431 2013 Patterns of autophagy in urothelial cell carcinomas--the significance of "stone-like" structures (SLS) in transurethral resection biopsies.
22267086 2012 Mitochondrial outer-membrane protein FUNDC1 mediates hypoxia-induced mitophagy in mammalian cells.
22249245 2012 A transcriptional variant of the LC3A gene is involved in autophagy and frequently inactivated in human cancers.
22237724 2012 Reduced expression of microtubule-associated protein 1 light chain 3 in hypertrophic scars.
22011618 2011 Spatiotemporally controlled initiation of Parkin-mediated mitophagy within single cells.
21943220 2011 c-Jun NH2-terminal kinase activation is essential for up-regulation of LC3 during ceramide-induced autophagy in human nasopharyngeal carcinoma cells.
21845828 2011 [Expression of microtubule-associated protein 1 light chain 3 in laryngeal carcinoma].
21812771 2011 Decreased gene expression of LC3 in peripheral leucocytes of patients with coronary artery disease.
21729531 2011 [Expression of autophagy related gene Beclin1 and MAPLC3 in bone marrow mononuclear cells isolated from acute leukemia patients and its significance].
21709020 2011 PERK integrates autophagy and oxidative stress responses to promote survival during extracellular matrix detachment.
21684337 2011 Alteration of autophagosomal proteins (LC3, GABARAP and GATE-16) in Lewy body disease.
21674156 2011 Immunohistochemical localization of autophagosomal membrane-associated protein LC3 in granular cell tumor and schwannoma.
21628531 2011 Inhibition of protein degradation induces apoptosis through a microtubule-associated protein 1 light chain 3-mediated activation of caspase-8 at intracellular membranes.
21617041 2011 Phosphorylation of the autophagy receptor optineurin restricts Salmonella growth.
21556768 2012 Decreased expression of Beclin-1 and LC3 in human lung cancer.
21537144 2011 Beclin-1 and LC3A expression in cutaneous malignant melanomas: a biphasic survival pattern for beclin-1.
21507968 2011 Subversion of cellular autophagy machinery by hepatitis B virus for viral envelopment.
21497758 2011 LC3 and GATE-16 N termini mediate membrane fusion processes required for autophagosome biogenesis.
21415575 2011 Overexpression of microtubule-associated protein-1 light chain 3 is associated with melanoma metastasis and vasculogenic mimicry.
21412173 2011 Localization of MAP1-LC3 in vulnerable neurons and Lewy bodies in brains of patients with dementia with Lewy bodies.
21316776 2011 MiR-204 regulate cardiomyocyte autophagy induced by hypoxia-reoxygenation through LC3-II.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
21045561 2011 Binding preference of p62 towards LC3-ll during dopaminergic neurotoxin-induced impairment of autophagic flux.
20937856 2010 p53-dependent regulation of autophagy protein LC3 supports cancer cell survival under prolonged starvation.
20713600 2010 Regulation of the autophagy protein LC3 by phosphorylation.
20639871 2010 Autophagy negatively regulates Wnt signalling by promoting Dishevelled degradation.
20562859 2010 Network organization of the human autophagy system.
20529957 2010 Ubiquilin functions in autophagy and is degraded by chaperone-mediated autophagy.
20505359 2010 Mammalian Atg18 (WIPI2) localizes to omegasome-anchored phagophores and positively regulates LC3 lipidation.
20479004 2010 The prolyl isomerase Pin1 induces LC-3 expression and mediates tamoxifen resistance in breast cancer.
20398630 2010 Protein kinase C inhibits autophagy and phosphorylates LC3.
20382705 2010 LC3A-positive light microscopy detected patterns of autophagy and prognosis in operable breast carcinomas.
20352102 2010 Nucleocytoplasmic distribution and dynamics of the autophagosome marker EGFP-LC3.
20061800 2010 Processing of autophagic protein LC3 by the 20S proteasome.
20023420 2010 Defective autophagy associated with LC3 puncta in epothilone-resistant cancer cells.
20010802 2010 Nix is a selective autophagy receptor for mitochondrial clearance.
20004946 2010 Beclin 1 and LC3 autophagic gene expression in cutaneous melanocytic lesions.
19812190 2009 Beta1 integrin-dependent engulfment of Yersinia enterocolitica by macrophages is coupled to the activation of autophagy and suppressed by type III protein secretion.
19696020 2009 The ubiquitin-like protein LC3 regulates the Rho-GEF activity of AKAP-Lbc.
19623642 2009 Immunohistochemical expression of MAP1LC3A and MAP1LC3B protein in breast carcinoma tissues.
19427866 2009 Interactions with LC3 and polyubiquitin chains link nbr1 to autophagic protein turnover.
19322194 2009 The structure of Atg4B-LC3 complex reveals the mechanism of LC3 processing and delipidation during autophagy.
19250911 2009 A role for NBR1 in autophagosomal degradation of ubiquitinated substrates.
19056683 2009 The TP53INP2 protein is required for autophagy in mammalian cells.
18695874 2008 LC3, an autophagosome marker, is highly expressed in gastrointestinal cancers.
18688877 2008 Induction of incomplete autophagic response by hepatitis C virus via the unfolded protein response.
18653543 2008 The N-terminus and Phe52 residue of LC3 recruit p62/SQSTM1 into autophagosomes.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17804493 2007 Modification of cellular autophagy protein LC3 by poliovirus.
17580304 2007 p62/SQSTM1 binds directly to Atg8/LC3 to facilitate degradation of ubiquitinated protein aggregates by autophagy.
17438365 Macroautophagy as a pathomechanism in sporadic inclusion body myositis.
17102583 Identification of essential residues for the C-terminal cleavage of the mammalian LC3: a lesson from yeast Atg8.
16381901 2006 The LIFEdb database in 2006.
16341674 2005 Transcriptome analysis of human gastric cancer.
16303767 2006 Phosphatidylserine in addition to phosphatidylethanolamine is an in vitro target of the mammalian Atg8 modifiers, LC3, GABARAP, and GATE-16.
15857831 2005 Solution structure of microtubule-associated protein light chain 3 and identification of its functional subdomains.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15383276 2004 A protein interaction network links GIT1, an enhancer of huntingtin aggregation, to Huntington's disease.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15213446 2004 1H, 13C, and 15N resonance assignments of human microtubule-associated protein light chain-3.
15187094 2004 HsAtg4B/HsApg4B/autophagin-1 cleaves the carboxyl termini of three human Atg8 homologues and delipidates microtubule-associated protein light chain 3- and GABAA receptor-associated protein-phospholipid conjugates.
12740394 2003 Post-translational modifications of three members of the human MAP1LC3 family and detection of a novel type of modification for MAP1LC3B.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11825910 2002 Human Apg3p/Aut1p homologue is an authentic E2 enzyme for multiple substrates, GATE-16, GABARAP, and MAP-LC3, and facilitates the conjugation of hApg12p to hApg5p.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11278895 2001 Differential binding regulation of microtubule-associated proteins MAP1A, MAP1B, and MAP2 by tubulin polyglutamylation.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11096062 2001 The human homolog of Saccharomyces cerevisiae Apg7p is a Protein-activating enzyme for multiple substrates including human Apg12p, GATE-16, GABARAP, and MAP-LC3.
11076863 2000 DNA cloning using in vitro site-specific recombination.
8833088 1996 Gene localization and developmental expression of light chain 3: a common subunit of microtubule-associated protein 1A(MAP1A) and MAP1B.
7908909 1994 Molecular characterization of light chain 3. A microtubule binding subunit of MAP1A and MAP1B.
2470876 1989 MAP 1A and MAP 1B are structurally related microtubule associated proteins with distinct developmental patterns in the CNS.