Property Summary

Ligand Count 470
NCBI Gene PubMed Count 533
PubMed Score 2492.06
PubTator Score 1692.71

Knowledge Summary


No data available


  Disease (9)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
substance-related disorder 162 0.0 0.9
Disease Target Count Z-score Confidence
Intellectual disability 1016 3.323 1.7
Disease Target Count
Monoamine oxidase A deficiency 1


  Differential Expression (26)

Disease log2 FC p
Endometriosis -1.685 7.2e-03
adult high grade glioma -1.100 2.3e-03
atypical teratoid / rhabdoid tumor -1.100 2.4e-03
Breast cancer -1.500 6.4e-04
breast carcinoma -2.200 1.5e-03
colon cancer -1.500 3.0e-02
ductal carcinoma in situ -3.800 1.1e-04
facioscapulohumeral dystrophy -1.400 4.2e-02
glioblastoma -1.500 4.3e-03
group 4 medulloblastoma -1.300 6.5e-04
interstitial cystitis -2.600 5.5e-04
interstitial lung disease -1.100 3.8e-02
invasive ductal carcinoma -4.400 3.8e-04
lung adenocarcinoma -1.100 1.4e-06
lung cancer -3.300 2.0e-05
lung carcinoma -2.000 5.2e-17
malignant mesothelioma -5.300 3.0e-08
nasopharyngeal carcinoma -1.200 4.1e-02
nephrosclerosis -1.245 2.8e-02
non-small cell lung cancer -1.804 3.3e-13
ovarian cancer -2.300 2.9e-10
pancreatic cancer -1.100 2.7e-02
pancreatic ductal adenocarcinoma liver m... -1.859 1.4e-03
pituitary cancer 1.100 2.1e-05
psoriasis -1.200 1.5e-07
ulcerative colitis -1.900 2.0e-06

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (609)

AA Sequence

WERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS                                     491 - 527

Text Mined References (539)

PMID Year Title