Property Summary

NCBI Gene PubMed Count 506
PubMed Score 2411.25
PubTator Score 1692.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Intellectual disability 573 3.392 1.7

Expression

  Differential Expression (26)

Disease log2 FC p
Endometriosis -1.685 7.2e-03
nephrosclerosis -1.245 2.8e-02
interstitial lung disease -1.100 3.8e-02
malignant mesothelioma -5.300 3.0e-08
psoriasis -1.500 6.4e-10
sonic hedgehog group medulloblastoma -2.200 1.5e-07
glioblastoma -1.500 4.3e-03
atypical teratoid/rhabdoid tumor -2.100 1.4e-06
pancreatic ductal adenocarcinoma liver m... -1.859 1.4e-03
non-small cell lung cancer -1.804 3.3e-13
colon cancer -2.700 1.2e-04
lung cancer -5.600 2.6e-07
breast carcinoma -2.200 1.5e-03
interstitial cystitis -3.300 6.6e-06
lung adenocarcinoma -1.600 1.2e-11
pediatric high grade glioma -1.100 2.7e-03
nasopharyngeal carcinoma -1.200 4.1e-02
Breast cancer -2.200 2.0e-06
lung carcinoma -2.000 5.2e-17
ductal carcinoma in situ -3.800 1.1e-04
invasive ductal carcinoma -4.400 3.8e-04
ulcerative colitis -2.200 1.2e-06
ovarian cancer -3.500 1.6e-19
pituitary cancer 1.100 2.1e-05
pancreatic cancer -1.100 2.7e-02
facioscapulohumeral dystrophy -1.400 4.2e-02

Protein-protein Interaction (5)

Gene RIF (584)

PMID Text
26698543 the association of SLC6A4 and MAOA genes with measures of obesity
26633268 5HTTLPR and uMAOA polymorphisms were not risk factors for depression.
26632697 There was no significant relationship between Migraine susceptibility and genetic polymorphisms of MAO-A-VNTR.
26620113 Our study substantiates the involvement of the monoamine oxidase A and 5,10-methylenetetrahydrofolate reductase polymorphisms in climacteric depression.
26546820 These findings demonstrate that regulation of monoamine levels by Mao activity in beta cells is pivotal for physiological insulin secretion and that loss of MaoB expression may contribute to the beta cell dysfunction in type 2 diabetes.
26494873 evidence of a moderating effect of the MAOA gene on antisocial outcomes in a population-based sample of young males; higher risks for antisocial outcomes were observed in males carrying the MAOA low-frequency alleles in comparison with high-frequency allele carriers for most outcomes when exposed to violence
26481676 These results indicate a possible impact of the MAOA-promotor polymorphism on the neurobiological modulation of aggressive behavior
26449393 A functional promoter polymorphism, MAOA-LPR, plays a role in determining continuity of parent-rated attention problems during adolescence
26228323 Genetic variation in MAOA was associated with the anger subscale of an aggressive behavior self report questionnaire in Pakistani men.
26196864 These data support part of our hypothesis that NHLH2 or MAO-A polymorphism is associated with sedentary behavior.
26174679 a functional polymorphism in the monoamine oxidase A gene associated with telomere length was characterized in a South American sample.
26101773 This paper addresses the contribution of mitochondrial dysfunction to the pathogenesis of heart failure and diabetes together with the mounting evidence for an emerging role of MAO inhibition as putative cardioprotective strategy in both conditions.
26081301 Study demonstrated lower brain MAO-A levels in antisocial personality disorder, support an important extension of preclinical models of impulsive aggression into a human disorder marked by pathological aggression and impulsivity
26051160 findings indicate that the low activity of monoamine oxidase gene polymorphisms has a protective effect on smoking cessation and smoking frequency.
26035919 MAOA T941G and TNF-beta G252A gene polymorphisms appear to contribute to photophobia but not to osmophobia
25857233 Report isolation of MOA-A inhibitors from Vernonia cinerea.
25826396 The 3/3 genotype of the 30-bp VNTR polymorphism in the monoamine oxidase A promoter region does not contribute to the development of depressive symptoms in late-reproductive-age women.
25810277 Regulation of MAOA gene expression in ischemia and inflammation was by GATA2, Sp1 and TBP.
25809512 No association was found between alcohol dependence and MAOA gene polymorphism.
25794322 the MAOA-L genotype is to some extent associated with impulsive and antisocial personality traits in alcoholic men
25793616 The findings do not support an association between DSM-IV OCD and the variants of COMT or MAO-A.
25747527 The findings support a possible association, depending on gender, between the MAOA-uVNTR polymorphism and psychopathological disorders such as anxiety.
25708001 The MAOA gene has been related to human behavior and specifically to violence and antisocial behavior.
25671411 protein environment of MAO-A enhances the polar nucleophilic character of the mechanism compared to that of MAO-B
25660313 did not find significant pooled Odds Ratios for any of the six genes, under different models and stratifying for ethnicity.
25655492 Significant correlations were proved between the allele frequency of the 30-bp variable-number tandem repeat (VNTR) polymorphism in the MAO-A promoter region and the incidence of depressive symptoms in the women analysed (p </= 0.05)
25623016 replication study of MAOA methylation which (a) confirms that female subjects with a history of depression are hypomethylated compared to controls and (b) shows that females are hypermethylated in the same region compared to males.
25618115 An overall comparison between the genotype of MAOA and MAOB genes and allele frequencies of the patients and the control group did not reveal any statistically significant difference between tension headache patients and the control group.
25522433 The genetic variants previously shown to confer vulnerability for delinquency (BDNF Val66Met Val/Met x 5-HTTLPR S x MAOA-uVNTR S) were associated with the lowest delinquency scores in interaction with a positive child-parent relationship.
25510658 The convicted Afro-Caribbeans were significantly more likely to have low activity MAOA polymorphisms than never convicted Afro-Caribbeans
25502632 Results suggest a role for KLF11 in upregulating MAO-A in depressive disorder and chronic social stress, suggesting that inhibition of the pathways regulated by this transcription factor may aid in the therapeutics of neuropsychiatric illnesses
25497297 results offer the first evidence suggesting epigenetic mechanisms may contribute to MAOA dysregulation in antisocial offenders.
25398695 Huntington disease neural cells exhibit increased Monoamine oxidase-A and Monoamine oxidases-B expression and activity
25389533 MAO-A single nucleotide polymorphism variants are significantly linked with oral and pharyngeal cancer in patients.
25349169 Finnish prisoners, revealed that a monoamine oxidase A (MAOA) low-activity genotype (contributing to low dopamine turnover rate) as well as the CDH13 gene (coding for neuronal membrane adhesion protein) are associated with extremely violent behavior
25331606 Results emphasize the importance of childhood as a sensitive period in which accumulating adversity might increase the vulnerability to externalizing psychopathology in MAOA-L males and MAOA-H females
25198178 the expression of MAOA is induced by exposure to cytotoxic chemotherapy, increases HIF1alpha, and contributes to docetaxel resistance
25082653 In summary, these findings support the role of MAOA gene as a prominent genetic determinant for criminal violence
25060544 Individuals with an allele associated with reduced MAOA activity were 9.8 times as likely to be convicted of a violent offense as adults, but only if they also had a history of maltreatment as children.
25028974 higher MAOA activity may be protective with respect to internalizing problems in internationally adopted Chinese girls.
24983833 The low expressing allele of the MAOA-variable number tandem repeat polymorphism genotype (MAOAL) interacted with abuse to predict self-reports of less serious criminal and delinquent behavior and had a direct association with serious criminal activity.
24971323 Lower spontaneous brain activity in the pons of the MAOA-L male adolescents may provide a neural mechanism by which boys with the MAOA-L genotype confers risk for impulsivity and aggression.
24902785 Both the 5HTTLPR and the MAOA-uVNTR were significantly associated with aggressive or antisocial behaviors across studies
24889756 Results show that influence of COMT on social working memory (WM) performance was not accounted for by its influence on either standard WM paradigms; there was no main effect of DAT1 or MAOA, but significant COMTxDAT1 interaction on social WM performance
24865426 MAOA-dependent HIF1alpha/VEGF-A/FOXO1/TWIST1 pathway was activated in high-grade prostate cancer (PCa) specimens, and knockdown of MAOA reduced or eliminated prostate tumor growth and metastasis in PCa xenograft models.
24809685 The present pilot data do not support a major role of MAO-A DNA methylation in driving antidepressant treatment response.
24805005 childhood trauma and the functional MAOA-LPR polymorphism may interact to specifically increase risk for over aggressive behavior but not impulsivity or hostility.
24791650 Exploratory multilocus polygenic analyses with p <0.05 showed an association of optimism with SNPs in MAOA, IL10, and FGG genes, and an association of resilience with a SNP in MAOA.
24671068 Results provide novel evidence of MAOA gene involvement in male human spatial navigation using a virtual analogue of the Morris Water Maze task
24652311 study is interpreted that MAOA gene variants may contribute to the etiology of ADHD as well as associated co-morbid conduct disorder and oppositional defiant disorder in an eastern Indian ethnic group.
24607627 We found that MAOA expression was significantly downregulated in 254 clinical hepatocellular carcinoma samples and was closely correlated with cancer vasoinvasion, metastasis, and poor prognoses.
24510409 exonic SNPs (rs6323, rs1137070, and rs3027407) of the MAOA gene may be contributed to affective disturbances of Korean males schizophrenia, especially restricted affect and blunted affect.
24494688 investigation of role of MAOA-uVNTR in cortical pain processing in healthy individuals measured by the trigeminal electric pain-related evoked potential (tPREP); the MAOA-uVNTR polymorphism seemed to influence brain response in a repeated tPREP paradigm and suggested a role of MAOA as a modulator of neural plasticity related to cortical pain processing
24451655 Study shows that the MAOA genotype, which has been repeatedly associated with aggression, influences brain activity already during rest
24443391 MAOA-uVNTR did not associate with either Alzheimer's disease and depression
24422758 The results revealed that no significant association was found in the MAOA gene promoter variable number of tandem repeat polymorphism and Tourette's syndrome in Chinese Han population.
24360188 This study provided the evidence for the first time that MAOA-uVNTR has a significant association with Excessive daytime sleepiness in healthy subjects.
24356376 These results indicate that language and speech ability is affected by an interaction between FOXP2 and MAOA, but not by either gene separately.
24355137 5-HTTVNTR and MAOA-LPR may have independent predictive effects on co-morbid BPD in female heroin-dependent patients.
24326626 African-American males who carry the 2-repeat MAOA allele are significantly more likely than all other genotypes to engage in shooting and stabbing behaviors and to report having multiple shooting and stabbing victims.
24314147 The frontal abnormality of patients with depression had certain 5-HT genetic basis, and 5-HT2A receptor CC allele and MAOA-H genotype had synergistic effect on the activity abnormality when recognizing negative emotion in right frontal middle gyrus.
24291416 results of this study identify MAOA as a possible ASD susceptibility locus and the differential genetic effect in males and females might contribute to the sex ratio differences and molecular pathology of the disorder.
24286237 This article indicates that the VNTR in the promoter of the MAOA gene is not involved in SIDS
24247011 The results highlight the role of Asn181 and Ile335 in MQAOA in assisting the interaction of the nitrile-containing aminofuran ring.
24244526 MicroRNA-142 reduces monoamine oxidase A expression and activity in neuronal cells by downregulating SIRT1.
24229476 MAOA gene polymorphism is associated with test anxiety.
24169519 Data indicate missense mutation in monoamine oxidase A (MAOA) in a boy with autism spectrum disorder, attention deficit and autoaggressive behavior, and his two maternal uncles carry the mutation and have severe intellectual disability.
24008922 Individual SNPs in MAO-A did not influence prevalence or time to onset of levodopa-induced dyskinesias in this Parkinson's disease patient cohort
23888755 Allelic polymorphism ofVall58Met OMT and VNTR MAO-A in promoter area did not differ between subject groups. Patients with genotype Val/ Val of polymorphism Val 158MetCOMT showed major cognitive deficits in paranoid schizophrenia.
23881096 The AP-2beta polymorphism significantly influenced cognitive performance, whereas the MAOA and COMT polymorphisms did not.
23866280 not proven that MAOA-u variable number of tandem repeats polymorphism is associated with adolescent major depressive disorder
23786983 This study found common regulatory variation in MAOA to moderate effects of childhood maltreatment on male antisocial behaviors, but less consistent, finding in female subjects.
23761378 the genetic effects of MAOA uVNTR polymorphism on body mass index in a Chinese adolescent population
23755928 Cocaine users carrying the MAOA (low activity) show a greater impact of cocaine use on impulsivity and behavioral measures of orbitofrontal cortex dysfunction.
23746540 Depending on MAOA genotype, ADHD symptoms in adolescent boys are associated with either reward deficiency or insufficient response inhibition.
23746491 no association between promoter VNTR polymorphisms and obsessive-compulsive disorder
23742855 Data suggest suicidal behavior is partly heritable; there is no evidence of direct association between MAOA and genetic predisposition to suicidality; data suggest MAOA involvement in aggression, impulsivity and other suicide endophenotypes. [REVIEW]
23738520 The first evidence of moderation by the MAOA gene of effects of parenting on infant anger proneness is an important early risk for the development of disruptive and aggressive behavior disorders.
23726513 This study could not confirm the hypothesis that MAOA genotype moderates the relationship between childhood maltreatment and adult antisocial behaviors.
23707423 study did not confirm differences between the frequency of genotypes and alleles of the 30-bp VNTR polymorphism in the MAO-A promoter region and the occurrence of depressive symptoms in women.
23627963 In boys, low-activity monoamine oxidase A gene was associated with increases in child anxiety and depression in interaction with caretaker depression, hostility, family conflict, and family stress.
23548774 Prefrontal affective and cognitive control during regulation of approach-avoidance behavior is modulated by variations in the MOA-A gene.
23544600 Polymorphisms in the monoamine oxidase A (MAOA-LPR) and serotonin receptor 2A genes (rs6314) moderated the effect of food reinforcement on body mass index.
23499704 Our data are in line with earlier studies and indicate the MAOA-uVNTR-genotype to be specifically associated with measures of reactive impulsive experimental aggressiveness in healthy men and women
23480342 The low activity variant of the monoamine oxidase A (MAOA) functional promoter polymorphism moderates the effect of the social environment in pregnancy on negative emotionality in infancy, an early risk for the development of child and adult antisocial behaviour disorders.
23449091 Depression in females may result from a gene x childhood-adversity interaction and/or a dysregulated epigenetic programming of MAOA.
23391042 Our results suggest a role of MAO-A in female SIDS pathogenesis exerted by functionally relevant allelic and genotype variants of the MAO-A polymorphism
23344637 COMT Val158Met polymorphism and the promoter polymorphism in MAOA were associated with tardive dyskinesia neither independently nor jointly in Chinese population.
23319006 This study demonstrated that patients with long MAOA risk alleles (causing higher activity of MAO-A) profited less from exposure-based CBT as reflected by lower response rates in a controlled, randomized trial.
23313272 None of the genetic markers within SLC6A4, MAOA, TPH1 and TPH2 were significantly associated with completed suicide or suicide method in the basic association tests.
23247077 results suggest that the MAOA gene may have a role in the development of physical aggression prior to adolescence.
23215821 No main genetic or interaction effects between MAOA polymorphisms, childhood maltreatment, and adolscent conduct disorders was found. This fails to replicate earlier findings.
23197227 MAO-A expression in high-grade tumours may have a direct role in maintaining a dedifferentiated phenotype and promoting aggressive behaviour.
23157339 This study detected allelic or genotypic associations of MAOA in clinically significant depression in Alzheimer;s disease .
23116433 The association between MAOA promoter methylation and carotid intima-media thickness is largely explained by familial factors shared by the twins.
23111930 This study demonistrated that an association between genetic variation in three polymorphisms of the MAOA and anger traits in suicidal males and one replication for the functional variant rs6323 in females.
23088179 Associations between adolescents' physical activity and depressive symptoms are not modified by plasticity genes.
23076524 This is the first report investigated the association between MAOA and DAT1 polymorphism at molecular level in Saudi Arabia population as well as Arab world.
23067570 The findings show that increases in aggressive behavior occur after social exclusion and are moderated by the MAOA-LPR polymorphism.
23054588 DBH and MAOA can influence human attentional biases, and there is a gene-gene interaction between the DBH and MAOA on attentional bias for negative expressions.
23044341 the interaction between the MAOA-uVNTR 3-repeat polymorphism and DRD2 A1/A2 allele was a risk factor in the comorbidity of alcoholism and bipolar disorder.
22985017 Wefound that the Monoamine oxiadse -A low-activity variant compared with the high-activity variant was associated with higher levels of the impulsive-antisocial traits of externalizing spectrum of psychopathology.
22948232 These results suggest that the methylation status of the MAOA promoter (detected in white blood cells) can reliably predict the brain endophenotype
22911667 high-expression MAOA-uVNTR alleles significantly increase the risk towards Panic disorder in women
22906985 While inhibition of both IL-6 signaling and DNA methylation restored MAOA levels to those observed in cholangiocytes, forced MAOA overexpression inhibited cholangiocarcinoma growth and invasion.
22832821 These results suggest a mediating role of WM brain activity and capacity in linking the MAOA gene to aggressive behavior during development.
22781862 Among maltreated children, polymorphisms of MAOA were related to heightened self-report and of antisocial behavior.
22711722 Correspondence between 5HTT and MAOA polymorphisms in idiopathic apparent life-threatening events and SIDS suggests that the 2 syndromes are different expressions of a common etiopathogenesis.
22627167 our results suggest for the first time the combined effect of suspected genotypes of 5HTT and MAOA genes on individuals' predisposition to severe alcoholic subtype.
22619623 study concluded the 1460T allele of MAO-A appeared with a higher frequency in depressed female patients than in control group and the patients with the 1460CT TT genotypes showed an increased risk of depression, which indicates the 1460T allele of MAO-A may be a risk factor for depression in postmenopausal women
22569243 MAOA down-regulation was observed in 100% of tumors studied, irrespectively of genetic alteration identified
22473857 A rare polymorphism of the monoamine oxidase A promoter previously shown to confer low expression was associated with a reduced risk of developing prostate cancer.
22436428 The present pilot data suggest a potential role of MAOA gene hypomethylation in the pathogenesis of panic disorder particularly in female patients
22351881 The monomanine oxidase A promoter length polymorphism is an important risk factor in the development of sudden infant death syndrome.
22336227 mRNA levels of monoamine oxidase A were significantly higher in neonates and infants.
22198720 abnormalities of DNA methylation at the MAOA promoter may be associated with schizophrenia in males
22193458 The contribution of polymorphisms, such as MAOA T941G, MTHFR C677T, and TNF-beta G252A, were more important than personality traits in the pathogenesis of migraine, a multifactorial disorder.
22162429 The interaction between genetic variants within the MAOA gene may contribute to an increased risk of paranoid schizophrenia.
22041522 No significant association was found in our study between MAOA-uVNTR polymorphism and suicidal behavior in psychiatric patients.
22030358 Provided evidence for the role of MAOA genotype as a moderator of the relationship between childhood maltreatment and mental health outcomes.
21983350 The vntr region of MAOA is genetic linking to working memory performance.
21978760 No significant associations were observed for the MAOA functional polymorphism with schizophrenia in Han Chinese.
21971004 [review] The roles of MAO-A are discussed in the context of regulating neuronal survival and death, while the search continues for a novel strategy to protect neurons that are involved in age-associated neurodegenerative disorders and depression.
21971001 [review] While MAO-A has high affinity for serotonin and norepinephrine, MAO-B primarily serves in the catabolism of 2-phenylethylamine (PEA) and contributes to the degradation of other trace amines and dopamine.
21971000 [review] Although the crystal structure of human MAO-A is monomeric while MAO-B is dimeric, both enzymes are dimeric in their membrane-bound forms.
21934643 significant association of this gene variants with idiopathic intellectual disability in eastern Indian probands, especially in female with behavioral problems
21912392 Genetically based reduced MAOA and COMT functioning is associated with the cortisol stress response.
21912191 significant effects of the 5-HTTLPR and MAOA-EcoRV polymorphisms on the attentional dimension of trait EI were observed in males.
21884321 results indicated that regulatory behavior was associated with the functional MAOA gene polymorphism in girls, but not boys
21819071 Rat MAO A exhibits functional properties similar but not identical with those of the human enzyme, providing additional support for C-H bond cleavage via a polar nucleophilic
21775495 Sequence analysis, electrophoretic mobility shift and chromatin immunoprecipitation assays showed the presence of a functional FoxO1-binding site in monoamine oxidase A core promoter.
21761555 our results provide some evidence that MAOA may be associated with the ADHD-HI subtype and support the association between MAOA and impulsivity, which may be a potential endophenotype of ADHD.
21698196 showed that there is a significant association between individuals' behavior in a repeated public goods game and MAOA
21610556 The presence of a short 5HTT-LPR or short MAOA-variable number of tandem repeats allele, in combination with high levels of platelet MAOB enzyme activity was associated with higher scores of attention-deficit hyperactivity disorder-like problems.
21605465 MAOA 4R allele affects vulnerability to suicide through the mediating factor of depressive symptoms. Further studies are needed to verify the psychopathology of the relationships among MAOA uVNTR polymorphism, symptom profiles, and suicidal behavior
21538940 The MAOA gene is located on chromosome X and due to its role in metabolism of both catecholamine and serotonin, a connection to autism is plausible.
21530215 MAOAu-VNTR and COMT Val158Met polymorphisms might have an impact on children's eating behavior.
21521428 Results found that two single nucleotide polymorphism in MAO-A gene were associated with heavy betel quid use.
21516943 There were no significant differences in the allele and genotype frequencies between the case and control group. In the individual genotype tests, examination of the distribution differences of each genotype.
21422455 Lesion location and MAO-A genotype interact in mediating aggression in PTBI.
21383264 Long-term cocaine users with the low-repeat MAOA allele have enhanced sensitivity to gray matter loss, specifically in the orbitofrontal cortex, indicating that this genotype may exacerbate the deleterious effects of cocaine in the brain.
21359973 [review] A better understanding of the transcriptional regulation of MAO A may help explain the differential tissue-specific expression of these two isoenzymes and provide insights into the molecular basis of the disorders associated with MAO dysfunction.
21302344 study found no evidence for main effects of MAOA variation on cognitive functions, but there were apparent interactions between the COMT and MAOA genes in their effects on working memory in boys
21299892 MAOA was found to have bimodal expression in human skeletal muscle tissue.
21295226 The high-activity MAOA allele is protective against antisocial personality among whites with no history of physical abuse, lending support to a link between MAOA expression and antisocial behavior.
21273708 No significant association was observed among any of the particular alleles/genotypes with that of idiopathic pulmonary hypertension.
21236646 this study suggested that the reported impact of the MAO A polymorphism on amygdala function is not coupled with consistent volumetric changes in healthy subjects
21177257 Parkin degrades ESRRA, ESRRB and ESRRG to limit the expression of MAOA and MAOB.
21152968 In male youth, MAOA genotype was significantly associated with levels of overt antisocial behavior across a 6-year period.
21147794 Carriers of the MAOA-L polymorphism were more likely to take financial risks; they exhibited such behavior because they are able to make better financial decisions under risk. No behavioral differences were found among the 5-HTT and DRD4 polymorphisms.
21114364 These remarks suggest that MAO-A and SSAO may play an important role in vascular tissue as well as in the vascular pathophysiology of type 2 diabetes.
21099450 The interaction effect between monoaminergic genes and environmental stressors is likely to contribute to vulnerability for Postpartum depression.
21075085 Quantitative enzyme radioautography reveals increased MAO-A and -B in Huntington's disease.
21039487 Observational study of gene-disease association. (HuGE Navigator)
20967566 Observational study of gene-disease association. (HuGE Navigator)
20873971 MAOA gene polymorphism has been implicated in aggression and impulsive behaviour Read More: http://informahealthcare.com/doi/full/10.3109/15622975.2010.518628
20869421 This study found link the MAOAuVNTR high-function alleles with increased risk of self-directed harm in bulimic females.
20862259 Observational study of gene-disease association. (HuGE Navigator)
20850185 This study suggested that MAOA genotype as predictors of violent reconvictions.
20820831 Confirmed association between monoamine oxidase A molecular polymorphisms and Sudden Infant Death Syndrome.
20734127 a functional polymorphism in the MAOA gene promoter and childhood maltreatment may have a role in the prediction of adolescent male and female delinquency
20734127 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
20731636 The present study supports the hypothesis that there is a relation between MAOA u-VNTR and alcohol consumption and that this relation is modulated by environmental factors.
20731636 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20729761 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20691428 The cis-phase interaction between the VNTR polymorphism and functional SNPs may contribute to the etiology of MDD.
20691428 Observational study of gene-disease association. (HuGE Navigator)
20677440 The paranoid schizophrenic patients with genotype of 4/4 of polymorphism VNTR MAO-A showed deeper empathy/theory of mind deficits
20677440 Observational study of gene-disease association. (HuGE Navigator)
20652353 This study showed that the association between genotypic and allelic frequencies of the analyzed SNPs and the grade of response to triptan administration showed a significant correlation for MAOA uVNTR polymorphism.
20652353 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20595415 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20589923 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20573161 Findings indicate the importance of considering maternal genotype in examining associations of MAOA and other genes with behavior in male offspring.
20573161 Observational study of gene-disease association. (HuGE Navigator)
20497231 Age and genotype interacted in the left amygdala, in which the predicted effect of genotype on responses to rejection stimuli was seen in the adults, but not in the adolescents.
20497231 Observational study of gene-disease association. (HuGE Navigator)
20485326 identified a 240 kb deletion on Xp11.3-p11.4, encompassing MAOA and MAOB but does not affect the adjacent Norrie disease gene;the brothers with the deletion presented with developmental delay, intermittent hypotonia and stereotypical hand movements
20477771 Although the MAOA gene alone is not associated with anxiety-depressive alcohol dependence, variants of MAOA tandem-repeat polymorphisms modify the ALDH2*2 allele protective effects in anxiety-depressive alcohol dependence of Han Chinese men in Taiwan.
20477771 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20464528 Observational study of gene-disease association. (HuGE Navigator)
20461808 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20435093 Observational study of gene-disease association. (HuGE Navigator)
20421737 A regulatory mechanism for the human MAOA according to which the MAOA expression in vivo is executed by the generation of tissue-specific transcripts initiated from the alternative promoters, is proposed.
20374544 These data suggest that the MAOA T941G polymorphism, which has been previously linked with mood disorders, is associated with a maladaptive pattern of affective responding in women
20374544 Observational study of gene-disease association. (HuGE Navigator)
20364435 Individuals with the low MAOA activity genotype who reported childhood sexual assault had more symptoms than individuals with either the high MAOA activity genotype and/or no history of childhood sexual assault.
20364435 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20354746 Observational study of gene-disease association. (HuGE Navigator)
20351714 Observational study of gene-disease association. (HuGE Navigator)
20332182 Findings suggest that the three promoter polymorphisms of MAOA, 5-HTT, and NET influence gene expression levels and protein activity of these genes in placentas, potentially leading to different fetal levels of maternal monoamine neurotransmitters.
20332182 Observational study of gene-disease association. (HuGE Navigator)
20303364 Surface-based analysis of the cortical mantle showed that the MAO A genotype was associated with structural differences in the orbitofrontal cortex; the MAO A High-activity group showed the highest cortical thickness value.
20303364 Observational study of gene-disease association. (HuGE Navigator)
20218801 association between heroin dependence in Chinese men and promoter VNTR polymorphisms, and interaction with polymorphisms in DRD4 exon 3
20218801 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20213484 Observational study of gene-disease association. (HuGE Navigator)
20206656 Observational study of gene-disease association. (HuGE Navigator)
20204405 Anti-depressant drugs that target MAOA, such as clorgyline, may find a new application in treating prostatic cancer.
20201935 Carriers of the monoamine oxidase A-H allele are at high risk of committing severely recidivistic, impulsive, violent crimes after exposure to heavy drinking and childhood physical abuse.
20201935 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20175604 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20152292 Male carriers of low MAOA activity alleles are at risk for becoming a gang member and, once a gang member, are at risk for using weapons in a fight
20152292 Observational study of gene-disease association. (HuGE Navigator)
20127808 Observational study of gene-disease association. (HuGE Navigator)
20078943 MAOA gene is associated with major depression in the Chinese Han population, especially among female patients.
20078943 Observational study of gene-disease association. (HuGE Navigator)
20046877 Subjects with the high activity (4-repeat) allele of MAOA are characterized by a preference for the longshot lottery and also less insurance purchasing than subjects with the low activity (3-repeat) allele.
20041956 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20033274 Observational study of gene-disease association. (HuGE Navigator)
20010318 Meta-analysis of gene-disease association. (HuGE Navigator)
19951362 The adverse consequences of physical discipline on forms of externalizing behavior are exacerbated by an underlying biological risk conferred by MAOA genotype.
19951362 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19941049 Gene-gene interaction between COMT and MAOA may have a role in intelligence of attention-deficit hyperactivity disorder boys in China
19941049 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19935847 The aim of this study was to investigate possible associations of functional polymorphisms within the IL-6, 5-HTT, and MAO-A genes with endurance performance of Ironman triathletes.
19935847 Observational study of gene-disease association. (HuGE Navigator)
19915868 Results show that some MAOA alleles, which have a higher enzyme activity, predispose to the development of gout.
19915868 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19892410 Observational study of gene-disease association. (HuGE Navigator)
19874574 Observational study of gene-disease association. (HuGE Navigator)
19859025 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19829167 Observational study of gene-disease association. (HuGE Navigator)
19818126 Observational study of gene-disease association. (HuGE Navigator)
19796878 The results of this study showed that significant associations between cold pain tolerance and MAOA (p =0,024).
19777560 smoking reliably decreases MAOA methylation in DNA prepared from lymphoblasts and whole blood
19727210 Observational study of gene-disease association. (HuGE Navigator)
19693267 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19666839 Identify a novel mechanism whereby MAO-A can contribute to increased oxidative stress in human heart valves and pulmonary artery exposed to serotonin and dopamine.
19657584 MAOA single nucleotide polymorphisms were not related to personality in this study
19657584 Observational study of gene-disease association. (HuGE Navigator)
19645722 Ser209 in MAO A does not appear to be the putative phosphorylation site for regulation of MAO A activity and the membrane environment plays a significant role in stabilizing the structure of MAO A and its mutant forms.
19642709 A common variant in the MAOA gene may be associated with problem behavior in adults with intellectual/developmental disabilities.
19642709 Observational study of gene-disease association. (HuGE Navigator)
19625011 The carriers of low activity variants of both monoamine oxidase A and catechol-O-methyltransferase and the high activity variant of 5-HTT, developed depressive symptoms in the course of the peripartum.
19625011 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19593178 Report monoamine oxidase a and catechol-o-methyltransferase functional polymorphisms and the placebo response in major depressive disorder.
19593178 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19583892 Regression of aggression on child saturation is steeper for those with low activity of the MAOA allele than among those with high activity version of the allele.
19573521 Genetic variants of monoamine oxidase A appear to play a role in susceptibility to schizophrenia in Chinese men.
19548263 Observational study of gene-disease association. (HuGE Navigator)
19539632 The Ca(2+)-sensitive component to MAO-A activity is present in human brain and in vitro studies link it to the p38(MAPK) pathway.
19506906 Meta-analysis of gene-disease association. (HuGE Navigator)
19506579 Observational study of gene-disease association. (HuGE Navigator)
19492728 Analysis revealed a statistically significant Gene x Environment interaction in which the high-MAOA activity allele increased the odds of fraudulent behaviors
19485616 Observational study of gene-disease association. (HuGE Navigator)
19455600 Observational study of gene-disease association. (HuGE Navigator)
19415821 A substantial influence of CYP2A6 polymorphism as well as the interaction with MAOA resulting in risk modulation on smoking behavior in Chinese male population.
19415821 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19398936 Individuals with high MAO-A activity had more externalizing behaviour than those with low MAO-A activity.
19382113 investigates the association of MAOA genetic polymorphisms and response to mirtazapine in patients with major depressive disorder
19382113 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19368859 high-activity allele class of MAOA-u variable-number tandem repeat in males may be involved in susceptibility to a persistent course of methamphetamine psychosis.
19368859 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19357553 High perceived parental care mitigated the effect of a childhood stressor on impulsivity scores in low-expressing MAOA-uVNTR allele carriers, but level of perceived care had no effect in the group homozygous for the high-expressing MAOA-uVNTR allele
19357553 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19337825 We examined the interaction between depressive symptoms and functional polymorphisms of serotonin transporter (SLC6A4) and monoamine oxidase A (MAOA) on categories of BMI.
19337825 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19333405 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19309535 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19302089 The protective effects of the ALDH2*2 allele against alcoholism might disappear in subjects with antisocial personality disorder and carrying MAOA-uVNTR 4-repeat allele in the Han Chinese male population.
19302089 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19267171 Observational study of gene-disease association. (HuGE Navigator)
19255579 the MAOA uVNTR genotype, prenatal exposure to cigarettes and sex interact to predict antisocial behavior and related information-processing patterns
19255579 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19248248 in the umbilical artery of preeclamptic pregnancy, a decrease of MAO-A and eNOS protein expression levels are probably associated with, or responsible for, the exaggerated 5-HT-induced tension development.
19247474 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19224413 In analyses of haplotype frequencies and multiple logistic regression, MAOA polymorphisms were not associated with either MDD or its subgroups. The results suggest that MAOA polymorphisms do not play a major role in MDD or its subgroups.
19223155 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19214141 Association of MAOA gene functional promoter polymorphism with CSF dopamine turnover and atypical depression is reported.
19214141 Observational study of gene-disease association. (HuGE Navigator)
19194374 This study suggested that the specificity of MAOA genotype effects on the personality traits on an antisocial index and evented releated potential measures of emotional brain function
19194374 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19168625 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19120058 Finnish high activity MAOA genotyped risk alcoholics exhibiting antisocial behavior, high alcohol consumption, and abnormal alcohol-related impulsive and uncontrolled violence might represent an etiologically distinct alcohol dependence subtype.
19120058 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19100789 The result of case-control global haplotype analysis also showed a statistically significant difference in haplotype frequencies between ASD patients and controls.
19100789 Observational study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
19077664 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19064571 Observational study of gene-disease association. (HuGE Navigator)
19058789 Observational study of gene-disease association. (HuGE Navigator)
19032968 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19005081 Females bearing the MAOA genotype 3/4 are at increased risk of depression relative to either 3/3 or 4/4 homozygote.
19005081 Observational study of gene-disease association. (HuGE Navigator)
18971477 Higher-activity MAO-A genotypes in women, but not in men, are associated with greater 5-HT1A receptor binding potential in numerous brainstem and forebrain regions.
18971477 Observational study of gene-disease association. (HuGE Navigator)
18955512 Observational study of gene-disease association. (HuGE Navigator)
18937309 Sex factor effects are described for MAOA in genetic association with ADHD.
18937309 Observational study of gene-disease association. (HuGE Navigator)
18845200 This study suggest a gender-specific contribution of MAOA-VNTR polymorphism to persistence scores.
18832011 Observational study of gene-disease association. (HuGE Navigator)
18827956 Observational study of gene-disease association. (HuGE Navigator)
18810510 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18752729 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18726986 Differential association between MAOA, ADHD and neuropsychological functioning in boys and girls is reported.
18726986 Observational study of gene-disease association. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18639608 Individuals with less active MAOA-uVNTR alleles who are under chronic stress may be at increased risk for exhaustion of the HPA response to such stress.
18639608 Observational study of gene-disease association. (HuGE Navigator)
18626920 High-activity variants of the uMAOA polymorphism increase the risk for depression in large primary care sample.
18626920 Observational study of gene-disease association. (HuGE Navigator)
18607773 Observational study of gene-disease association. (HuGE Navigator)
18596609 Data show that individuals carrying the MAO A-high activity variant show substantial relative grey matter decreases in the bilateral orbitofrontal cortex.
18596609 Observational study of gene-disease association. (HuGE Navigator)
18566880 Children with the 4- versus 3-repeat allele had significantly (p < 05) more severe parent-rated ADHD inattention and impulsivity, and more severe teacher-rated symptoms of generalized anxiety.
18566880 Observational study of gene-disease association. (HuGE Navigator)
18544183 genetic variation in the MAOA gene may affect the course of major depression by disrupting cortico-limbic connectivity
18544183 Observational study of gene-disease association. (HuGE Navigator)
18504633 5-HT2C receptor and MAOA interaction analysis showed no association among this intergenic haplotype combination and suicidal behaviour in bipolar disorder.
18504633 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18501009 Observational study of gene-disease association. (HuGE Navigator)
18486967 Observational study of gene-disease association. (HuGE Navigator)
18474080 our data nevertheless argue against a major genetic role of MAO-A polymorphism in frontotemporal dementia.
18474080 Observational study of gene-disease association. (HuGE Navigator)
18463263 Because trait aggression is a measure used to predict antisocial behavior, these results underscore the relevance of MAO A as a neurochemical substrate of aberrant aggression.
18454435 Methylation of the monoamine oxidase A promoter may play a significant role in common psychiatric illness in women, but not men.
18437281 Data show that MAOA promoter polymorphisms uVNTR and EcoRV are not associated with bipolar disorder or any of its subtypes, in either the frequencies of alleles or genotypes.
18437281 Observational study of gene-disease association. (HuGE Navigator)
18430257 In boys hemizygosity for the short MAO-A hemizygosity for the short MAO-A Variable Number of Tandem Repeats(VNTR) allele is s associated with disruptive behavior allele is associated with disruptive behavior.
18430257 Observational study of gene-disease association. (HuGE Navigator)
18405071 Observational study of gene-disease association. (HuGE Navigator)
18405062 Observational study of gene-disease association. (HuGE Navigator)
18391214 flexibility of loop 108-118, facilitated by anchoring the enzyme into the membrane, is essential for controlling substrate access to the active s
18388730 MAOA-uVNTR polymorphism can affect activation of limbic regions, elicited by negative emotional stimuli.
18388730 Observational study of gene-disease association. (HuGE Navigator)
18387780 Role of genes TPH2, 5-HTT, and MAOA regulating the serotonin metabolic pathway in the brain stain in the etiopathogenesis of the sudden infant death syndrome was studied.
18387780 Observational study of gene-disease association. (HuGE Navigator)
18361446 association between the MAOA "low activity" allele and larger brain volumes for regions of the cortex in children with autism
18361446 Observational study of gene-disease association. (HuGE Navigator)
18337637 The study suggest gender-specific contribution of the more active MAO-A VNTR variant to an increased vulnerability for complicated grief as a potential intermediate phenotype of major depression.
18337637 Observational study of gene-disease association. (HuGE Navigator)
18294618 Our data reveal pronounced MAO-A genotype-related functional changes in specific prefrontal region (VLPFC) subserving spatial working memory.
18294618 Observational study of gene-disease association. (HuGE Navigator)
18270970 Observational study of genotype prevalence. (HuGE Navigator)
18261931 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18258310 Article discusses the low-expressing allele of the MAOA u-VNTR in information processing within a circuit composed of amygdala, rostral cingulate and medial prefrontal cortex, and provides a model for gene-environment interactions in impulsive aggression.
18248494 monoamine oxidase A prevents basal epithelial cells from differentiating into secretory cells.
18239643 SLC6A4 and MAOA genes are implicated in dopamine and serotonin regulation on energy balance.
18239643 Observational study of gene-disease association. (HuGE Navigator)
18227761 Higher total cholesterol (p<0.03), LDL/HDL ratio (p<0.01), triglycerides (p<0.02), and VLDL (p<0.02) were associated with low activity MAOA-uVNTR alleles.
18227761 Observational study of gene-disease association. (HuGE Navigator)
18212819 The association analysis shows that men with a 2 repeat report a level of serious delinquency and violent delinquency in adolescence and young adulthood; the results for women are similar, but weaker
18188752 Trends were observed for interactions between the DRD4 gene and, among males, the MAOA gene and ADHD symptoms to predict smoking risk.
18188752 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18092818 These data suggest that the structural properties of the active site cavities in rat MAOs are significantly different from the two human enzymes, which correlates with the differences in the inhibitor specificities between human and rat MAOs.
18079067 Observational study of gene-disease association. (HuGE Navigator)
18075472 Observational study of gene-disease association. (HuGE Navigator)
18075472 Contribution of the MAOA gene, parenting style and their interactions to variation in the risk for early onset behavior disorders and liability to substance use disorders.
18046979 Functional polymorphism leads to variable expression or change of MAO activity and exerts an impact on the onset of mental disorders, such as: schizophrenia, affective disorders, forms of alcohol dependence, and personality and behavioural disorders.
18046978 Polymorphisms of genes MAO-A and COMT were described in relation to their expression altered activity; influence on cognitive functions, affective and anxiety disorders, learning disabilities, aggressive behaviour, eating disorders or gender differences.
18029114 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18023041 study does not support previous reports of an interaction between monoamine oxidase A genotype and childhood adversity for antisocial behavior in males.
18023041 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17944104 5-HT2A and MAOA genes, regulating activity of serotonin, influence on subjective time flow.
17943028 Observational study of gene-disease association. (HuGE Navigator)
17943028 findings support the hypothesis that the MAO-A variable number of tandem repeat polymorphism in the promoter region may be associated with anger-related personality traits in Korean women
17931441 Heightened depressive symptoms were found only among extensively maltreated youth with low MAOA activity.
17920180 There were no relationship between MAOA-uVNTR polymorphisms and novelty-seeking personality traits in Korean females.
17920180 Observational study of gene-disease association. (HuGE Navigator)
17894408 no significant evidence of association with the two schizophrenia susceptibility polymorphisms monoamine oxidase A gene .
17894408 Meta-analysis of gene-disease association. (HuGE Navigator)
17885758 Analyzed the genotype distributions and allele frequencies for the MAO-A and MAO-B polymorphism of the MAO gene among the patients with fibromyalgia syndrome.
17885625 Observational study of gene-disease association. (HuGE Navigator)
17885625 This study may suggest a role of the COMT Val158Met polymorphism in smoking behavior in Japanese individuals.
17884271 Monoamine oxidase A variant influences antidepressant treatment response in female patients with Major Depression.
17883400 MAO-A, through its production of reactive oxygen species as a by-product of its catalytic activity on the mitochondrial surface, is recruited by the cell to enhance apoptotic signalling.
17868476 Increases in intracellular Ca2+ availability could contribute to a MAO-A-mediated mechanism with a role in Alzheimer's disease-related oxidative stress.
17728669 Observational study of gene-disease association. (HuGE Navigator)
17692293 Observational study of gene-disease association. (HuGE Navigator)
17692293 Our data suggest that the MAOA-VNTR affects the activity and gene expression of MAOA in the brain of AD patients, and is involved in the changes of monoamine metabolism.
17680543 No association between MAOA gene and schizophrenia is found in Chinese Han population, but CT genotype is likely to be a susceptible factor of male schizophrenia.
17680543 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17657171 Observational study of gene-disease association. (HuGE Navigator)
17657171 The MAO-A genes may be involved in aggressive schizophrenic patients.
17627031 Observational study of gene-disease association. (HuGE Navigator)
17592478 MAOA seems to moderate the impact of childhood trauma on adult psychopathology in female subjects in the same way as previously shown among male subjects.
17592478 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17585061 Observational study of gene-disease association. (HuGE Navigator)
17585061 Individuals with less active MAOA-uVNTR alleles may be at increased risk for depressive symptoms and poor sleep
17563839 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17534436 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17519928 Our data implicate a neural circuit for variation in human personality under genetic(MAOA) control.
17476365 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17476365 The monoamine oxidase-A gene may modify the association between the dopamine D2 receptor gene and alcohol dependence and anxiety, depression or both phenotype.
17453062 Observational study of gene-disease association. (HuGE Navigator)
17453062 Study showed evidence of interactions between MAOA and MD susceptibility in baseline ACTH measures indicating a role for these genotypes in stable-state endocrine regulation.
17449559 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17440951 Observational study of gene-disease association. (HuGE Navigator)
17429405 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17429405 plausible explanations for previous Inconsistencies in studies of the relationship between testosterone and MAOA genotype and male human aggression.
17427196 Observational study of gene-disease association. (HuGE Navigator)
17427196 The current study examined the association between adolescent outcome of attention-deficit/hyperactivity disorder and MAO gene polymorphisms.
17426915 Observational study of gene-disease association. (HuGE Navigator)
17417058 Observational study of gene-disease association. (HuGE Navigator)
17417058 monoamine oxidase A gene may play an important role in the etiological development of the borderline personality disorder by means of various polymorphisms.
17400359 monoamine oxidase expression during in vitro differentiation of human preadipocytes and in adipose and stroma-vascular fractions of human fat depots
17393061 Our study indicates that MAO catalytic activity is involved in apoptotic signalling in response to serum withdrawal in neuronal cells.
17340199 Observational study of gene-disease association. (HuGE Navigator)
17328795 Observational study of gene-disease association. (HuGE Navigator)
17298646 Observational study of gene-disease association. (HuGE Navigator)
17295220 alleles of MAOA have been shown to confer functional variation in stress (Review)
17230031 Observational study of gene-disease association. (HuGE Navigator)
17221847 Observational study of gene-disease association. (HuGE Navigator)
17221847 study reports the learning process of decision-making in suicide attempters to be modulated by four serotonergic gene polymorphisms, 5HTTLPR, TPH1 A218C, MAOA u-VNTR, and TPH2 rs1118997
17217235 Observational study of gene-disease association. (HuGE Navigator)
17208375 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17192957 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17192957 Time course of response and antidepressant efficacy of mirtazapine, but not paroxetine, seem to be influenced in a clinically relevant manner by this allelic variation within the MAOA gene, at least in female patients.
17167335 Promoter polymorphism is observed in mental retardation, such as Down syndrome.
17141746 The lack of an association between the high and low MAO A genotype and brain MAO A activity suggests that this polymorphism by itself does not contribute to differences in brain MAO A activity in healthy adult male subjects.
17044053 Observational study of gene-disease association. (HuGE Navigator)
17034017 Observational study of gene-disease association. (HuGE Navigator)
17026953 Observational study of gene-disease association. (HuGE Navigator)
17026953 These findings do not support a major role for common 5-hydroxytryptamine transporter, TPH1, and monoamine oxidase A polymorphisms in contributing to susceptibility to premenstrual dysphoric disorder.
17020906 There is a a strong association between endometrial receptivity and MAO-A expression in the endometrial epithelium, suggesting an important role for this enzyme in normal implantation.
17008143 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17008143 Findings from this general population sample could not confirm the hypothesis that MAOA moderates the relationship between adolescent maltreatment and adolescent or adult antisocial behavior.
17007976 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16958037 Observational study of gene-disease association. (HuGE Navigator)
16958037 family-based association study gives mild but further support of the involvement of MAOA variants in bipolar disorder
16944667 Observational study of gene-disease association. (HuGE Navigator)
16930369 Observational study of gene-disease association. (HuGE Navigator)
16896926 Observational study of gene-disease association. (HuGE Navigator)
16896926 the association of MAOA genetic variation with a large set of quantitative behavioural traits in normal individuals
16894395 Observational study of gene-disease association. (HuGE Navigator)
16893905 Therefore, allelic mRNA expression is affected by genetic and epigenetic events, both with the potential to modulate biogenic amine tone in the CNS.
16890910 results show that the MAO-A gene has mono-allelic expression in skin fibroblasts; this could have important implications for understanding traits that display gender differences
16856146 Observational study of gene-disease association. (HuGE Navigator)
16848906 Observational study of gene-disease association. (HuGE Navigator)
16829576 demonstrates the functions of MAO A and its repressor R1(RAM2/CDCA7L/JPO2) in apoptotic signaling pathways
16814261 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16814261 Genotypes associated with high levels of MAOA activity buffered abused and neglected whites from increased risk of becoming violent and/or antisocial in later life. This protective effect was not found for non-white abused and neglected individuals.
16806099 Observational study of gene-disease association. (HuGE Navigator)
16801953 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
16801953 Meta-analysis demonstrated that across studies, the association between maltreatment and mental health problems is significantly stronger in the group of males with the genotype conferring low vs high MAOA activity.
16770335 Observational study of gene-disease association. (HuGE Navigator)
16770335 MAOA may be involved in the regulation of body mass index in controls and in alcoholic criminals.
16763378 Observational study of gene-disease association. (HuGE Navigator)
16763378 In alcohol-dependent heavily smoking men there is evidence for a MAO-A gene-associated effect on the quantity that is smoked as reflected by the daily number of cigarettes consumed.
16741202 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16728402 monoamine oxidase A activation of glucocorticoids and androgens is regulated differently by R1 and Sp1
16725119 Observational study of gene-disease association. (HuGE Navigator)
16674552 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16610949 Observational study of gene-disease association. (HuGE Navigator)
16584839 Observational study of gene-disease association. (HuGE Navigator)
16547693 Observational study of gene-disease association. (HuGE Navigator)
16538182 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16538181 Observational study of gene-disease association. (HuGE Navigator)
16538181 The monoamine oxidase A promoter region variable number tandem repeat polymorphism affects novelty seeking and reward dependence in healthy study participants.
16526025 Observational study of gene-disease association. (HuGE Navigator)
16526025 Results confirmed previous reports showing an association of the low activity 3-repeat allele of MAOA-uVNTR polymorphism with substance dependence and impulsive/antisocial behaviors.
16360899 Observational study of gene-disease association. (HuGE Navigator)
16319504 Observational study of gene-disease association. (HuGE Navigator)
16319504 The hypothesis that gene variants could influence temperamental traits in mood disorders patients was tested. The long MAO-A allele was associated with decreased persistence scores among females.
16272956 Observational study of gene-disease association. (HuGE Navigator)
16207390 Observational study of gene-disease association. (HuGE Navigator)
16207390 there is an important association between MAOA polymorphisms and smoking status, suggesting a possible role of MAOA gene variants in nicotine dependence.
16202396 Observational study of gene-disease association. (HuGE Navigator)
16202396 a specific genetic variation of MAOA involving serotonergic catabolism can modulate BOLD response associated with human impulsivity
16186632 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16174289 Observational study of gene-disease association. (HuGE Navigator)
16174289 found a significant association between two MAOA gene haplotypes and reduced trbc-MAO activity, but no association with depressed state.
16139427 Observational study of gene-disease association. (HuGE Navigator)
16139427 The present results do not support the hypothesis that MAO-A gene polymorphism is related to certain personality traits in females.
16129825 important component of the active site structure of hMAO A is the loop conformation of residues 210-216, which differs from that of hMAO B and rat MAO A
16125147 Observational study of gene-disease association. (HuGE Navigator)
16125147 present study strongly supports the notion that carrying the 3-repeat allele of the MAO-A-gene promoter increases the risk of male adolescent criminal behavior, when interacting with psychosocial factors.
16110245 Observational study of gene-disease association. (HuGE Navigator)
16094253 Observational study of gene-disease association. (HuGE Navigator)
15990460 Observational study of gene-disease association. (HuGE Navigator)
15956990 Observational study of gene-disease association. (HuGE Navigator)
15956990 This study findings suggest that the MAOA-uVNTR may be involved in the pathogenesis of major depressive disorder and the antidepressant therapeutic mechanisms in Chinese population, and that there may be a gender effect in this association.
15936529 Observational study of gene-disease association. (HuGE Navigator)
15900229 Observational study of gene-disease association. (HuGE Navigator)
15900229 Monoamine oxidase A polymorphism could play a role in susceptibility to alcoholism, which may differ across sexes.
15870836 Observational study of gene-disease association. (HuGE Navigator)
15870836 This study findings further support the notion that allelic variation of MAOA activity contributes modestly to the balance of hyper- (impulsive-aggressive) and hyporeactive (anxious-depressive) traits.
15806601 Observational study of gene-disease association. (HuGE Navigator)
15722955 Observational study of gene-disease association. (HuGE Navigator)
15722955 High-activity MAOA promoter gene polymorphisms, as in aging, are a risk factor for telomeric shortening.
15694196 Observational study of gene-disease association. (HuGE Navigator)
15670397 Observational study of gene-disease association. (HuGE Navigator)
15635592 Observational study of gene-disease association. (HuGE Navigator)
15564894 Observational study of gene-disease association. (HuGE Navigator)
15564894 MAOA gene variation may modulate the expression of some clinical aspects of severe mood disorders.
15556933 monoamine oxidase A has a stable tyrosyl radical
15539858 Observational study of gene-disease association. (HuGE Navigator)
15523490 evidence in support of interaction between the MAOA and serotonin transporter (SERT) genes in 114 anorexia nervosa nuclear families (patient with AN plus biological parents)
15498245 Observational study of gene-disease association. (HuGE Navigator)
15486489 Observational study of gene-disease association. (HuGE Navigator)
15486489 These data suggest that the EcoRV and uVNTR polymorphisms may be involved in the pathogenesis of major depression and associated with insomnia in depressed patients.
15457497 Observational study of gene-disease association. (HuGE Navigator)
15450911 Observational study of gene-disease association. (HuGE Navigator)
15346539 Observational study of gene-disease association. (HuGE Navigator)
15341275 Observational study of genotype prevalence. (HuGE Navigator)
15292674 Observational study of gene-disease association. (HuGE Navigator)
15292674 our results do not confirm the hypothesis that there is a simple correlation between single gene polymorphisms in monoamine oxidase A and personality traits measurement
15261699 Observational study of gene-disease association. (HuGE Navigator)
15241435 Observational study of gene-disease association. (HuGE Navigator)
15211623 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15211623 There was no evidence of epistatic interaction between MAOA, MOAB, and COMT genes on Overt aggression scale scores.
15150530 Observational study of gene-disease association. (HuGE Navigator)
15150530 lower expression of the MAOA variable number tandem repeat polymorphism is related to a history of early abuse and may sensitize males, but not females, to the effects of early abuse experiences on impulsive traits in adulthood
15094788 Observational study of gene-disease association. (HuGE Navigator)
15088154 Observational study of gene-disease association. (HuGE Navigator)
15088153 Observational study of gene-disease association. (HuGE Navigator)
15052272 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15034227 association between the monoamine oxidase A (MAO-A) gene and obesity.
15024395 polymorphism is associated with aggression in children
14962671 Observational study of gene-disease association. (HuGE Navigator)
14697881 It is proposed that the FAD binding site in MAO A is quite similar to that in MAO B. Structural information in this review is used to explain previous studies on flavin analog incorporation into either MAO B or into MAO A.
14520117 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12919132 Observational study of gene-disease association. (HuGE Navigator)
12919132 Functional MAOA-uVNTR alleles may act as a genetic modifier of the severity of autism in males.
12886034 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12886034 This study showed that the genetic polymorphism of MAOA-VNTR might affect the incidence of nausea induced by SSRIs.
12877392 Observational study of gene-disease association. (HuGE Navigator)
12824808 Observational study of gene-disease association. (HuGE Navigator)
12824808 In a study of 129 Chinese Han males neither antisocial alcoholism nor antisocial personality disorder is found to be associated with genetic variants of the MAO-A gene.
12815746 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12815746 There was a weak association of MAOA in neuroticism only in males. The er was no significant interaction between COMT and MAOA.
12778446 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
12777388 study shows that the monoamine oxidase A structure is "more flexible" than that of monoamine oxidase B and that clorgyline and pargyline inactivation increase structural stability of both enzymes
12773616 genotyped 16 subjects for the DRD4 and MAOA genes who had been scanned during the Attention Network Test
12668354 Observational study of gene-disease association. (HuGE Navigator)
12650952 Observational study of gene-disease association. (HuGE Navigator)
12648733 Observational study of gene-disease association. (HuGE Navigator)
12629534 Observational study of gene-disease association. (HuGE Navigator)
12607224 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12607224 Mao-A gene promoter allele was found in panic disorder.
12566936 Observational study of gene-disease association. (HuGE Navigator)
12563176 Observational study of gene-disease association. (HuGE Navigator)
12563176 MAO-A polymorphisms are associated with smoking behaviour
12555234 Observational study of gene-disease association. (HuGE Navigator)
12555234 Comparison of male alcoholics to male normal controls for the frequencies of two-loci and three-loci haplotypes was statistically significant
12555227 Observational study of gene-disease association. (HuGE Navigator)
12555227 Investigation of possible ssociation of a T941G single nucleotide polymorphism with generalized anxiety disorder, panic disorder, or major depression showed an association with gneralized anxiety disorder only.
12554604 Observational study of gene-disease association. (HuGE Navigator)
12554604 These findings suggest that the three-repeat allele of the MAOAuVNTR 30-bp polymorphism is not associated with impulsive and aggressive personality traits.
12502014 Observational study of gene-environment interaction. (HuGE Navigator)
12497620 Observational study of gene-disease association. (HuGE Navigator)
12497620 Case control analysis of the VNTR showed an association with a subgroup of children with comorbid conduct problems.
12497608 Observational study of gene-disease association. (HuGE Navigator)
12445480 spectrum and redox properties are altered by inhibitors
12428723 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12399942 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12360111 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12360111 Single nucleotide polymorphism in smokers
12170473 Observational study of gene-disease association. (HuGE Navigator)
12164325 Observational study of genotype prevalence. (HuGE Navigator)
12163988 MAO-A promoter polymorphism is associated with Moclobemide response in depressed patients.
12161658 Role of genotype in the cycle of violence in maltreated children: Maltreated children with a genotype conferring high levels of MAOA expression were less likely to develop antisocial problems
12151768 Observational study of gene-disease association. (HuGE Navigator)
12140786 Observational study of gene-disease association. (HuGE Navigator)
12140786 a role for the MAO A promoter-region polymorphism in conferring risk for attention deficit hyperactivity disorder
12136060 Observational study of gene-disease association. (HuGE Navigator)
12116182 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12098640 Observational study of gene-disease association. (HuGE Navigator)
11999895 Observational study of gene-disease association. (HuGE Navigator)
11999895 No association exists between genetic variation at the MAOA locus and alcoholism in Chinese Han males in Taiwan.
11992560 Observational study of gene-disease association. (HuGE Navigator)
11992560 possible influence of monoamine oxydase A (MAO-A), catechol-O-methyltransferase (COMT), serotonin receptor 2A (5-HT2A), dopamine receptor D2 (DRD2), and dopamine receptor D4 (DRD4) gene variants on timing of recurrence in mood disorders
11992559 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11992559 possible association between the prophylactic efficacy of lithium in mood disorders and the following gene variants: catechol-O-methyltransferase (COMT) G158A, monoamine oxydase A (MAO-A) 30-bp repeat, G-protein beta 3-subunit (Gbeta3) C825T
11992558 study did not support the involvement of 5-HTTLPR, TPH, MAO-A, or DRD4 polymorphisms in mood disorders
11963571 Observational study of genotype prevalence. (HuGE Navigator)
11927135 Observational study of gene-disease association. (HuGE Navigator)
11920860 Observational study of gene-disease association. (HuGE Navigator)
11861643 Analysis of conserved active site residues in monoamine oxidase A and B and their three-dimensional molecular modeling
11805333 Evidence for positive selection and population structure at the human MAO-A gene.
11761322 Substrates but not inhibitors alter the redox potentials of monoamine oxidases.
11443519 Observational study of gene-disease association. (HuGE Navigator)
11353450 Observational study of gene-disease association. (HuGE Navigator)
11304831 Observational study of gene-disease association. (HuGE Navigator)
11140838 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11121185 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MENQEKASIAGHMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHVDYVDVGGAYV      1 - 70
GPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIAYLDYNNLWRTIDNMGKEIPT     71 - 140
DAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLFVNINVTSEPHEVSALWFLWYVKQCGGTTRIFSV    141 - 210
TNGGQERKFVGGSGQVSERIMDLLGDQVKLNHPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAK    211 - 280
IHFRPELPAERNQLIQRLPMGAVIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIM    281 - 350
GFILARKADRLAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYG    351 - 420
RVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLGKVTEKDIWVQEPESKDVPAVEITHTF    421 - 490
WERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS                                     491 - 527
//

Text Mined References (512)

PMID Year Title
26698543 2016 Association of polymorphisms in 5-HTT (SLC6A4) and MAOA genes with measures of obesity in young adults of Portuguese origin.
26633268 2015 [Association between serotonin transporter and monoamine oxidase A gene polymorphisms and depression].
26632697 2015 Association Between Polymorphisms of DRD2, COMT, DBH, and MAO-A Genes and Migraine Susceptibility: A Meta-Analysis.
26620113 2016 The MAOA, COMT, MTHFR and ESR1 gene polymorphisms are associated with the risk of depression in menopausal women.
26546820 2015 Islet-specific monoamine oxidase A and B expression depends on MafA transcriptional activity and is compromised in type 2 diabetes.
26494873 2016 Effects of the MAOA gene and levels of exposure to violence on antisocial outcomes.
26481676 2016 MAOA-VNTR polymorphism modulates context-dependent dopamine release and aggressive behavior in males.
26449393 2015 Monoamine oxidase A polymorphism moderates stability of attention problems and susceptibility to life stress during adolescence.
26228323 2015 Monoamine Oxidase A gene polymorphisms and self reported aggressive behaviour in a Pakistani ethnic group.
26196864 2015 A Genetic Basis for Motivated Exercise.
26174679 2015 Relative telomere length is associated with a functional polymorphism in the monoamine oxidase A gene in a South American sample.
26101773 2015 Monoamine Oxidases as Potential Contributors to Oxidative Stress in Diabetes: Time for a Study in Patients Undergoing Heart Surgery.
26081301 2015 Lower Monoamine Oxidase-A Total Distribution Volume in Impulsive and Violent Male Offenders with Antisocial Personality Disorder and High Psychopathic Traits: An [(11)C] Harmine Positron Emission Tomography Study.
26051160 2015 Association between monoamine oxidase gene polymorphisms and smoking behavior: A meta-analysis.
26035919 2014 MAOA and TNF-? gene polymorphisms are associated with photophobia but not osmophobia in patients with migraine.
25857233 2015 Inhibition effects of Vernonia cinerea active compounds against cytochrome P450 2A6 and human monoamine oxidases, possible targets for reduction of tobacco dependence.
25826396 2015 An analysis of the influence of selected genetic and hormonal factors on the occurrence of depressive symptoms in late-reproductive-age women.
25810277 2015 Molecular mechanism of monoamine oxidase A gene regulation under inflammation and ischemia-like conditions: key roles of the transcription factors GATA2, Sp1 and TBP.
25809512 2015 Monoamine oxidase a promoter variable number of tandem repeats (MAOA-uVNTR) in alcoholics according to Lesch typology.
25794322 2015 [Association between the MAOA-uVNTR polymorphism and antisocial personality traits in alcoholic men].
25793616 2015 COMT and MAO-A polymorphisms and obsessive-compulsive disorder: a family-based association study.
25747527 2015 Association study of monoamine oxidase-A gene promoter polymorphism (MAOA-uVNTR) with self-reported anxiety and other psychopathological symptoms in a community sample of early adolescents.
25708001 "Bad genes" & criminal responsibility.
25671411 2015 Influence of the environment on the oxidative deamination of p-substituted benzylamines in monoamine oxidase.
25660313 2015 Meta-analysis of six genes (BDNF, DRD1, DRD3, DRD4, GRIN2B and MAOA) involved in neuroplasticity and the risk for alcohol dependence.
25655492 2015 The assessment of the relationship between personality, the presence of the 5HTT and MAO-A polymorphisms, and the severity of climacteric and depressive symptoms in postmenopausal women.
25623016 2015 Hypomethylation of MAOA's first exon region in depression: a replication study.
25618115 Association analysis of the functional MAOA gene promoter and MAOB gene intron 13 polymorphisms in tension type headache patients.
25522433 2014 Genotypes do not confer risk for delinquency but rather alter susceptibility to positive and negative environmental factors: gene-environmentinteractions of BDNF Val66Met, 5-HTTLPR, and MAOA-uVNTR [corrected].
25510658 2014 MAOA, COMT and 5-HTTLPR frequencies in convicted and never convicted Afro-Caribbeans in the Netherlands.
25502632 2015 Evidence revealing deregulation of the KLF11-MAO A pathway in association with chronic stress and depressive disorders.
25497297 2015 Monoamine oxidase A gene promoter methylation and transcriptional downregulation in an offender population with antisocial personality disorder.
25398695 2015 Inhibition of Excessive Monoamine Oxidase A/B Activity Protects Against Stress-induced Neuronal Death in Huntington Disease.
25389533 2014 The influence of monoamine oxidase variants on the risk of betel quid-associated oral and pharyngeal cancer.
25349169 2015 Genetic background of extreme violent behavior.
25331606 2016 Evidence for a Sex-Dependent MAOA× Childhood Stress Interaction in the Neural Circuitry of Aggression.
25198178 2014 Chemotherapy-induced monoamine oxidase expression in prostate carcinoma functions as a cytoprotective resistance enzyme and associates with clinical outcomes.
25082653 2014 Association of low-activity MAOA allelic variants with violent crime in incarcerated offenders.
25060544 2015 Impact of behavioral genetic evidence on the perceptions and dispositions of child abuse victims.
25028974 2014 Preadoption adversity, MAOA, and behavioral adjustment in internationally adopted Chinese girls.
24983833 2014 Monoamine oxidase A genotype, childhood adversity, and criminal behavior in an incarcerated sample.
24971323 2014 A functional polymorphism of the MAOA gene modulates spontaneous brain activity in pons.
24902785 2014 Candidate genes for aggression and antisocial behavior: a meta-analysis of association studies of the 5HTTLPR and MAOA-uVNTR.
24889756 2014 Preliminary investigation of the influence of dopamine regulating genes on social working memory.
24865426 2014 Monoamine oxidase A mediates prostate tumorigenesis and cancer metastasis.
24809685 2015 Pharmacoepigenetics of depression: no major influence of MAO-A DNA methylation on treatment response.
24805005 2014 The interactive effect of MAOA-LPR genotype and childhood physical neglect on aggressive behaviors in Italian male prisoners.
24791650 2014 Candidate SNP associations of optimism and resilience in older adults: exploratory study of 935 community-dwelling adults.
24671068 2014 Evidence of MAOA genotype involvement in spatial ability in males.
24652311 2014 Potential contribution of monoamine oxidase a gene variants in ADHD and behavioral co-morbidities: scenario in eastern Indian probands.
24607627 2014 Monoamine oxidase A suppresses hepatocellular carcinoma metastasis by inhibiting the adrenergic system and its transactivation of EGFR signaling.
24510409 2014 Association study between monoamine oxidase A (MAOA) gene polymorphisms and schizophrenia: lack of association with schizophrenia and possible association with affective disturbances of schizophrenia.
24494688 2014 The upstream Variable Number Tandem Repeat polymorphism of the monoamine oxidase type A gene influences trigeminal pain-related evoked responses.
24451655 2015 Effect of MAOA Genotype on Resting-State Networks in Healthy Participants.
24443391 2014 Investigation of association of serotonin transporter and monoamine oxidase-A genes with Alzheimer's disease and depression in the VITA study cohort: a 90-month longitudinal study.
24422758 2015 Family-based association study between monoamine oxidase A (MAOA) gene promoter VNTR polymorphism and Tourette's syndrome in Chinese Han population.
24360188 2014 A functional polymorphism in the promoter region of MAOA gene is associated with daytime sleepiness in healthy subjects.
24356376 2014 Interaction between MAOA and FOXP2 in association with autism and verbal communication in a Korean population.
24355137 2014 The association of 5-HTR2A-1438A/G, COMTVal158Met, MAOA-LPR, DATVNTR and 5-HTTVNTR gene polymorphisms and borderline personality disorder in female heroin-dependent Chinese subjects.
24326626 2014 The 2-repeat allele of the MAOA gene confers an increased risk for shooting and stabbing behaviors.
24314147 2014 Synergistic effect of 5-HT2A receptor gene and MAOA gene on the negative emotion of patients with depression.
24291416 2014 Sexual dimorphic effect in the genetic association of monoamine oxidase A (MAOA) markers with autism spectrum disorder.
24286237 2014 Genetic variation in the monoamine oxidase A and serotonin transporter genes in sudden infant death syndrome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24252804 2013 The role of oxidative stress in Parkinson's disease.
24247011 2014 Exploring the structural basis of the selective inhibition of monoamine oxidase A by dicarbonitrile aminoheterocycles: role of Asn181 and Ile335 validated by spectroscopic and computational studies.
24244526 2013 MicroRNA-142 reduces monoamine oxidase A expression and activity in neuronal cells by downregulating SIRT1.
24229476 2013 The relationship between MAOA gene polymorphism and test anxiety.
24169519 2014 20 ans après: a second mutation in MAOA identified by targeted high-throughput sequencing in a family with altered behavior and cognition.
24008922 2014 Influence of single nucleotide polymorphisms in COMT, MAO-A and BDNF genes on dyskinesias and levodopa use in Parkinson's disease.
23888755 [Functional polymorphism of genes inactivating biogenic amines and cognitive deficits in paranoid schizophrenia].
23881096 2013 Neuropsychological correlates of transcription factor AP-2Beta, and its interaction with COMT and MAOA in healthy females.
23866280 2013 [Association between MAOA-u VNTR polymorphism and its interaction with stressful life events and major depressive disorder in adolescents].
23786983 2014 MAOA, childhood maltreatment, and antisocial behavior: meta-analysis of a gene-environment interaction.
23761378 2014 Gender difference in interactions between MAOA promoter uVNTR polymorphism and negative familial stressors on body mass index among Chinese adolescents.
23755928 2013 A MAOA gene*cocaine severity interaction on impulsivity and neuropsychological measures of orbitofrontal dysfunction: preliminary results.
23746540 2013 Neural mechanisms of attention-deficit/hyperactivity disorder symptoms are stratified by MAOA genotype.
23746491 2013 Association study between MAO-A gene promoter VNTR polymorphisms and obsessive-compulsive disorder.
23742855 2013 Serotonergic genes and suicide: a systematic review.
23738520 2013 Evidence for interplay between genes and parenting on infant temperament in the first year of life: monoamine oxidase A polymorphism moderates effects of maternal sensitivity on infant anger proneness.
23726513 2014 MAOA genotype, childhood maltreatment, and their interaction in the etiology of adult antisocial behaviors.
23707423 2013 The 5HTT and MAO-A polymorphisms associate with depressive mood and climacteric symptoms in postmenopausal women.
23627963 2013 Gene × environment effects of serotonin transporter, dopamine receptor D4, and monoamine oxidase A genes with contextual and parenting risk factors on symptoms of oppositional defiant disorder, anxiety, and depression in a community sample of 4-year-old children.
23548774 2013 Genetic variation in MAOA modulates prefrontal cortical regulation of approach-avoidance reactions.
23544600 2013 Two functional serotonin polymorphisms moderate the effect of food reinforcement on BMI.
23499704 2013 MAOA-uVNTR genotype predicts interindividual differences in experimental aggressiveness as a function of the degree of provocation.
23480342 2013 Evidence for interplay between genes and maternal stress in utero: monoamine oxidase A polymorphism moderates effects of life events during pregnancy on infant negative emotionality at 5?weeks.
23449091 2013 Genetic and epigenetic associations of MAOA and NR3C1 with depression and childhood adversities.
23391042 2013 Monoamine oxidase A gene polymorphism and the pathogenesis of sudden infant death syndrome.
23344637 2013 Association study on tardive dyskinesia and polymorphisms in COMT and MAOA in Chinese population.
23319006 2014 MAOA and mechanisms of panic disorder revisited: from bench to molecular psychotherapy.
23313272 2013 An association study of suicide and candidate genes in the serotonergic system.
23247077 2013 Age-dependent effect of the MAOA gene on childhood physical aggression.
23215821 2013 Gene-environment interaction in externalizing problems among adolescents: evidence from the Pelotas 1993 Birth Cohort Study.
23197227 2012 Comparison of expression pattern of monoamine oxidase A with histopathologic subtypes and tumour grade of renal cell carcinoma.
23157339 2013 Genetic risk factors for depression in Alzheimer`s disease patients.
23116433 2012 MAOA promoter methylation and susceptibility to carotid atherosclerosis: role of familial factors in a monozygotic twin sample.
23111930 2013 MAOA and MAOB polymorphisms and anger-related traits in suicidal participants and controls.
23088179 2013 Plasticity genes do not modify associations between physical activity and depressive symptoms.
23076524 2012 Association study between the dopamine-related candidate gene polymorphisms and ADHD among Saudi Arabia population via PCR technique.
23067570 2013 MAOA genotype, social exclusion and aggression: an experimental test of a gene-environment interaction.
23054588 2013 The effects of DBH, MAOA, and MAOB on attentional biases for facial expressions.
23044341 2013 Association study of DRD2 and MAOA genes with subtyped alcoholism comorbid with bipolar disorder in Han Chinese.
22985017 2013 Analysis of monoaminergic genes, childhood abuse, and dimensions of psychopathy.
22948232 2012 Evidence that the methylation state of the monoamine oxidase A (MAOA) gene predicts brain activity of MAO A enzyme in healthy men.
22911667 2012 Meta-analysis argues for a female-specific role of MAOA-uVNTR in panic disorder in four European populations.
22906985 2012 Monoamine oxidase A expression is suppressed in human cholangiocarcinoma via coordinated epigenetic and IL-6-driven events.
22832821 2012 Working memory brain activity and capacity link MAOA polymorphism to aggressive behavior during development.
22781862 2012 The effects of child maltreatment on early signs of antisocial behavior: genetic moderation by tryptophan hydroxylase, serotonin transporter, and monoamine oxidase A genes.
22711722 2012 Serotonin transporter role in identifying similarities between SIDS and idiopathic ALTE.
22627167 2012 Combination of polymorphic variants in serotonin transporter and monoamine oxidase-A genes may influence the risk for early-onset alcoholism.
22619623 2012 The c.1460C>T polymorphism of MAO-A is associated with the risk of depression in postmenopausal women.
22569243 2012 Monoamine oxidase A down-regulation contributes to high metanephrine concentration in pheochromocytoma.
22473857 2012 The monoamine oxidase A gene promoter repeat and prostate cancer risk.
22436428 2012 Monoamine oxidase A gene DNA hypomethylation - a risk factor for panic disorder?
22351881 2012 Association between a functional polymorphism in the MAOA gene and sudden infant death syndrome.
22336227 2012 Developmental changes in human dopamine neurotransmission: cortical receptors and terminators.
22198720 2012 Effects of MAOA promoter methylation on susceptibility to paranoid schizophrenia.
22193458 2012 MAOA, MTHFR, and TNF-? genes polymorphisms and personality traits in the pathogenesis of migraine.
22162429 2012 Study of a possible role of the monoamine oxidase A (MAOA) gene in paranoid schizophrenia among a Chinese population.
22041522 2012 Monoamine oxidase A gene polymorphism and suicide: an association study and meta-analysis.
22030358 2012 Child abuse and neglect, MAOA, and mental health outcomes: a prospective examination.
21983350 2011 Serotonergic modulation in executive functioning: linking genetic variations to working memory performance.
21978760 2011 Association study of monoamine oxidase A/B genes and schizophrenia in Han Chinese.
21971004 2011 Type A monoamine oxidase regulates life and death of neurons in neurodegeneration and neuroprotection.
21971001 2011 Behavioral outcomes of monoamine oxidase deficiency: preclinical and clinical evidence.
21971000 2011 Structural properties of human monoamine oxidases A and B.
21934643 2012 Association of monoamine oxidase A and serotonin transporter gene functional variants with intellectual disability related behavioral problems.
21912392 2012 Genetically based reduced MAOA and COMT functioning is associated with the cortisol stress response: a replication study.
21912191 2011 The effects of serotonin transporter promoter and monoamine oxidase A gene polymorphisms on trait emotional intelligence.
21884321 2011 The association between infants' self-regulatory behavior and MAOA gene polymorphism.
21819071 2011 ²H kinetic isotope effects and pH dependence of catalysis as mechanistic probes of rat monoamine oxidase A: comparisons with the human enzyme.
21775495 2011 Valproic acid induces monoamine oxidase A via Akt/forkhead box O1 activation.
21761555 2011 Association analyses of MAOA in Chinese Han subjects with attention-deficit/hyperactivity disorder: family-based association test, case-control study, and quantitative traits of impulsivity.
21698196 2011 Genetic susceptibility for individual cooperation preferences: the role of monoamine oxidase A gene (MAOA) in the voluntary provision of public goods.
21610556 2012 Associations of MAOA-VNTR or 5HTT-LPR alleles with attention-deficit hyperactivity disorder symptoms are moderated by platelet monoamine oxidase B activity.
21605465 2011 Association of the MAOA promoter uVNTR polymorphism with suicide attempts in patients with major depressive disorder.
21538940 2011 MAOA, DBH, and SLC6A4 variants in CHARGE: a case-control study of autism spectrum disorders.
21530215 2012 Association of MAOA and COMT gene polymorphisms with palatable food intake in children.
21521428 2012 Monoamine oxidase A variants are associated with heavy betel quid use.
21516943 Search for association between suicide and 5-HTT, MAOA and DAT polymorphism in Polish males.
21422455 2011 Prefrontal cortex lesions and MAO-A modulate aggression in penetrating traumatic brain injury.
21383264 2011 Gene x disease interaction on orbitofrontal gray matter in cocaine addiction.
21359973 2011 Transcriptional regulation and multiple functions of MAO genes.
21302344 2011 Cognitive effects of genetic variation in monoamine neurotransmitter systems: a population-based study of COMT, MAOA, and 5HTTLPR.
21299892 2011 Bimodal distribution of RNA expression levels in human skeletal muscle tissue.
21295226 Monoamine oxidase A regulates antisocial personality in whites with no history of physical abuse.
21273708 2010 MAO-A promoter polymorphism and idiopathic pulmonary arterial hypertension.
21236646 2011 MAO A VNTR polymorphism and amygdala volume in healthy subjects.
21179162 2010 A population-specific HTR2B stop codon predisposes to severe impulsivity.
21177257 2011 Parkin degrades estrogen-related receptors to limit the expression of monoamine oxidases.
21152968 2011 Deviant peer affiliation and antisocial behavior: interaction with Monoamine Oxidase A (MAOA) genotype.
21147794 2011 MAOA-L carriers are better at making optimal financial decisions under risk.
21114364 2011 Monoamine oxidase and semicarbazide-sensitive amine oxidase kinetic analysis in mesenteric arteries of patients with type 2 diabetes.
21099450 2011 Postpartum depression symptoms: a case-control study on monoaminergic functional polymorphisms and environmental stressors.
21075085 2011 Up-regulation of the isoenzymes MAO-A and MAO-B in the human basal ganglia and pons in Huntington's disease revealed by quantitative enzyme radioautography.
21039487 2011 Cumulative-genetic plasticity, parenting and adolescent self-regulation.
20967566 2011 Aggression, digit ratio and variation in androgen receptor and monoamine oxidase a genes in men.
20873971 2011 Association of polymorphisms of the serotonergic pathways with clinical traits of impulsive-aggression and suicidality in adolescents: a multi-center study.
20869421 2011 Molecular-genetic correlates of self-harming behaviors in eating-disordered women: findings from a combined Canadian-German sample.
20862259 2010 Genetic determinants of time perception mediated by the serotonergic system.
20850185 2011 Psychopathy, PCL-R, and MAOA genotype as predictors of violent reconvictions.
20833797 2011 Phosphoproteome analysis of functional mitochondria isolated from resting human muscle reveals extensive phosphorylation of inner membrane protein complexes and enzymes.
20820831 2011 Confirmed association between monoamine oxidase A molecular polymorphisms and Sudden Infant Death Syndrome.
20734127 2011 Maltreatment, MAOA, and delinquency: sex differences in gene-environment interaction in a large population-based cohort of adolescents.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20731636 2011 MAOA genotype, family relations and sexual abuse in relation to adolescent alcohol consumption.
20729761 2010 Gene-environment interaction of child temperament.
20691428 2010 A cis-phase interaction study of genetic variants within the MAOA gene in major depressive disorder.
20677440 [Functional polymorphism of genes inactivating catecholamines and emotional deficits in paranoid schizophrenia].
20652353 2010 Genetic polymorphisms related to efficacy and overuse of triptans in chronic migraine.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20595415 2010 Central nervous system serotonin and clustering of hostility, psychosocial, metabolic, and cardiovascular endophenotypes in men.
20589923 2010 Association study between antipsychotic-induced restless legs syndrome and polymorphisms of monoamine oxidase genes in schizophrenia.
20573161 2011 Autism severity is associated with child and maternal MAOA genotypes.
20497231 2010 Effects of age and MAOA genotype on the neural processing of social rejection.
20485326 2010 Deletion of MAOA and MAOB in a male patient causes severe developmental delay, intermittent hypotonia and stereotypical hand movements.
20477771 2010 MAOA interacts with the ALDH2 gene in anxiety-depression alcohol dependence.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20464528 2010 Association analysis between 12 genetic variants of ten genes and personality traits in a young chinese Han population.
20461808 2010 A case-control study of Parkinson's disease and tobacco use: gene-tobacco interactions.
20435093 2010 Epilepsy and serotonin (5HT): variations of 5HT-related genes in temporal lobe epilepsy.
20421737 2010 Identification and characterization of putative methylation targets in the MAOA locus using bioinformatic approaches.
20374544 2010 MAOA T941G polymorphism and the time course of emotional recovery following unpleasant pictures.
20364435 2010 Harsh discipline, childhood sexual assault, and MAOA genotype: an investigation of main and interactive effects on diverse clinical externalizing outcomes.
20354746 2010 Questionable association between a monoamine oxidase A promoter polymorphism and sudden infant death syndrome.
20351714 2011 Poor replication of candidate genes for major depressive disorder using genome-wide association data.
20332182 2010 Association of MAOA, 5-HTT, and NET promoter polymorphisms with gene expression and protein activity in human placentas.
20303364 2010 Morphological correlates of MAO A VNTR polymorphism: new evidence from cortical thickness measurement.
20218801 2010 Association of VNTR polymorphisms in the MAOA promoter and DRD4 exon 3 with heroin dependence in male Chinese addicts.
20213484 2010 Frequencies of genetic polymorphisms related to triptans metabolism in chronic migraine.
20206656 Catechol O-methyltransferase and monoamine oxidase A genotypes, and plasma catecholamine metabolites in bipolar and schizophrenic patients.
20204405 2010 Targeting monoamine oxidase A in advanced prostate cancer.
20201935 2010 MAOA alters the effects of heavy drinking and childhood physical abuse on risk for severe impulsive acts of violence among alcoholic violent offenders.
20187845 2010 Serotonin, genetic variability, behaviour, and psychiatric disorders--a review.
20175604 2010 Child maltreatment moderates the association of MAOA with symptoms of depression and antisocial personality disorder.
20152292 Monoamine oxidase A genotype is associated with gang membership and weapon use.
20127808 Aggressive behavior, related conduct problems, and variation in genes affecting dopamine turnover.
20078943 2009 [Association between monoamine oxidase A gene and major depression in Chinese Han population].
20046877 2009 Monoamine oxidase A gene (MAOA) associated with attitude towards longshot risks.
20041956 2010 Lack of association between schizophrenia and polymorphisms in dopamine metabolism and transport genes.
20033274 2010 Catechol-o-methyltransferase genotype and childhood trauma may interact to impact schizotypal personality traits.
20010318 2010 Meta-analysis of the association between the monoamine oxidase-A gene and mood disorders.
19951362 2010 MAOA-uVNTR and early physical discipline interact to influence delinquent behavior.
19941049 2010 Gene-gene interaction between COMT and MAOA potentially predicts the intelligence of attention-deficit hyperactivity disorder boys in China.
19935847 2009 The interleukin-6, serotonin transporter, and monoamine oxidase A genes and endurance performance during the South African Ironman Triathlon.
19915868 2010 Monoamine oxidase A gene polymorphisms and enzyme activity associated with risk of gout in Taiwan aborigines.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19892410 2010 Lack of association between antipsychotic-induced extrapyramidal symptoms and polymorphisms in dopamine metabolism and transport genes.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19859025 2009 Sex-specific interaction between MAOA promoter polymorphism and Apo epsilon 2 allele in major depressive disorder in the Chinese population.
19829167 2009 Psychopathy trait scores in adolescents with childhood ADHD: the contribution of genotypes affecting MAOA, 5HTT and COMT activity.
19818126 2009 Single nucleotide polymorphisms in obesity-related genes and all-cause and cause-specific mortality: a prospective cohort study.
19796878 2009 Associations between polymorphisms in dopamine neurotransmitter pathway genes and pain response in healthy humans.
19777560 2010 The effect of smoking on MAOA promoter methylation in DNA prepared from lymphoblasts and whole blood.
19727210 2009 [Association study of intelligence of attention deficit hyperactivity disorder children in China].
19693267 2009 Financial and psychological risk attitudes associated with two single nucleotide polymorphisms in the nicotine receptor (CHRNA4) gene.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19666839 2009 Serotonin produces monoamine oxidase-dependent oxidative stress in human heart valves.
19657584 2009 Negative emotionality: monoamine oxidase B gene variants modulate personality traits in healthy humans.
19645722 2009 Mutagenic probes of the role of Ser209 on the cavity shaping loop of human monoamine oxidase A.
19642709 2009 Monoamine oxidase a promoter gene associated with problem behavior in adults with intellectual/developmental disabilities.
19625011 2009 The development of peripartum depressive symptoms is associated with gene polymorphisms of MAOA, 5-HTT and COMT.
19593178 2009 Monoamine oxidase a and catechol-o-methyltransferase functional polymorphisms and the placebo response in major depressive disorder.
19583892 2009 Neighborhoods and genes and everything in between: understanding adolescent aggression in social and biological contexts.
19573521 2009 Association between monoamine oxidase (MAO)-A gene variants and schizophrenia in a Chinese population.
19548263 2010 A population-based association study of candidate genes for depression and sleep disturbance.
19539632 2009 Calcium alters monoamine oxidase-A parameters in human cerebellar and rat glial C6 cell extracts: possible influence by distinct signalling pathways.
19506906 2009 Candidate gene studies of ADHD: a meta-analytic review.
19506579 2009 A common variant in DRD3 gene is associated with risperidone-induced extrapyramidal symptoms.
19492728 2009 Biosocial influences on fraudulent behaviors.
19485616 2009 Neural mechanisms of anger regulation as a function of genetic risk for violence.
19455600 2010 Association study of the serotoninergic system in migraine in the Spanish population.
19415821 2009 Gene-gene interactions of CYP2A6 and MAOA polymorphisms on smoking behavior in Chinese male population.
19398936 2009 High activity of monoamine oxidase A is associated with externalizing behaviour in maltreated and nonmaltreated adoptees.
19382113 2009 MAOA gene polymorphisms and response to mirtazapine in major depression.
19368859 2009 An association study of monoamine oxidase A (MAOA) gene polymorphism in methamphetamine psychosis.
19357553 2009 Parental care moderates the influence of MAOA-uVNTR genotype and childhood stressors on trait impulsivity and aggression in adult women.
19337825 2009 Interactions between genotype and depressive symptoms on obesity.
19333405 2009 Prolactin levels in olanzapine treatment correlate with positive symptoms of schizophrenia: results from an open-label, flexible-dose study.
19309535 2009 MAOA is associated with methylphenidate improvement of oppositional symptoms in boys with attention deficit hyperactivity disorder.
19302089 2009 MAOA-uVNTR polymorphism may modify the protective effect of ALDH2 gene against alcohol dependence in antisocial personality disorder.
19267171 2009 No evidence for association between an MAOA functional polymorphism and susceptibility to Parkinson's disease.
19255579 2010 Interaction of prenatal exposure to cigarettes and MAOA genotype in pathways to youth antisocial behavior.
19248248 2009 Role of monoamine oxidases in the exaggerated 5-hydroxytryptamine-induced tension development of human isolated preeclamptic umbilical artery.
19247474 2009 Genome-wide and candidate gene association study of cigarette smoking behaviors.
19224413 2009 Association of monoamine oxidase A (MAOA) polymorphisms and clinical subgroups of major depressive disorders in the Han Chinese population.
19223155 2009 MAO-A and COMT genotypes as possible regulators of perinatal serotonergic symptoms after in utero exposure to SSRIs.
19214141 2009 Association of MAOA gene functional promoter polymorphism with CSF dopamine turnover and atypical depression.
19194374 2009 A polymorphism of the MAOA gene is associated with emotional brain markers and personality traits on an antisocial index.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19168625 2009 Monoamine oxidase A gene (MAOA) predicts behavioral aggression following provocation.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
19120058 2009 Effects of MAOA-genotype, alcohol consumption, and aging on violent behavior.
19100789 2009 Family- and population-based association studies of monoamine oxidase A and autism spectrum disorders in Korean.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19077664 2009 Resequencing of serotonin-related genes and association of tagging SNPs to citalopram response.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
19032968 2009 Serotonin genes and gene-gene interactions in borderline personality disorder in a matched case-control study.
19005081 2008 Relationship of genetic variability and depressive symptoms to adverse events after coronary artery bypass graft surgery.
18971477 2008 Monoamine oxidase A genotype predicts human serotonin 1A receptor availability in vivo.
18955512 2010 The intersection of genes and neuropsychological deficits in the prediction of adolescent delinquency and low self-control.
18937309 2008 Sexually dimorphic effects of four genes (COMT, SLC6A2, MAOA, SLC6A4) in genetic associations of ADHD: a preliminary study.
18845200 2008 Association between monoamine oxidase A (MAOA) and personality traits in Japanese individuals.
18832011 2008 Association testing of panic disorder candidate genes using CCK-4 challenge in healthy volunteers.
18827956 2008 Serotonin transporter (5-HTTLPR) and monoamine oxidase (MAOA) promoter polymorphisms in women with severe alcoholism.
18810510 2009 Association of dopamine transporter and monoamine oxidase molecular polymorphisms with sudden infant death syndrome and stillbirth: new insights into the serotonin hypothesis.
18752729 2009 Monoamine oxidase A and childhood adversity as risk factors for conduct disorder in females.
18726986 2008 Differential association between MAOA, ADHD and neuropsychological functioning in boys and girls.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18639608 2008 HPA axis function in male caregivers: effect of the monoamine oxidase-A gene promoter (MAOA-uVNTR).
18626920 2009 High-activity variants of the uMAOA polymorphism increase the risk for depression in a large primary care sample.
18607773 2009 The genetics of Alzheimer's disease in Brazil: 10 years of analysis in a unique population.
18596609 2008 MAO A VNTR polymorphism and variation in human morphology: a VBM study.
18566880 2009 Association of a monoamine oxidase-a gene promoter polymorphism with ADHD and anxiety in boys with autism spectrum disorder.
18544183 2009 Reduced amygdala-prefrontal coupling in major depression: association with MAOA genotype and illness severity.
18504633 2008 5-HT2C receptor and MAO-A interaction analysis: no association with suicidal behaviour in bipolar patients.
18501009 2008 Association analysis of monoamine oxidase A gene and bipolar affective disorder in Han Chinese.
18486967 2008 A community-based study of cigarette smoking behavior in relation to variation in three genes involved in dopamine metabolism: Catechol-O-methyltransferase (COMT), dopamine beta-hydroxylase (DBH) and monoamine oxidase-A (MAO-A).
18474080 2008 The functional MAOA-uVNTR promoter polymorphism in patients with frontotemporal dementia.
18463263 2008 Brain monoamine oxidase A activity predicts trait aggression.
18454435 2008 MAOA methylation is associated with nicotine and alcohol dependence in women.
18437281 2008 Neither single-marker nor haplotype analyses support an association between monoamine oxidase A gene and bipolar disorder.
18430257 2008 ADHD and Disruptive Behavior scores - associations with MAO-A and 5-HTT genes and with platelet MAO-B activity in adolescents.
18405071 2008 Alcohol dependence and polymorphisms of serotonin-related genes: association studies.
18405062 2008 Hyperserotonemia in autism: the potential role of 5HT-related gene variants.
18391214 2008 Structure of human monoamine oxidase A at 2.2-A resolution: the control of opening the entry for substrates/inhibitors.
18388730 2008 Monoamine oxidase A-uVNTR genotype affects limbic brain activity in response to affective facial stimuli.
18387780 2008 Genes regulating the serotonin metabolic pathway in the brain stem and their role in the etiopathogenesis of the sudden infant death syndrome.
18361446 2008 Cortical enlargement in autism is associated with a functional VNTR in the monoamine oxidase A gene.
18337637 2007 Association of MAO-A variant with complicated grief in major depression.
18294618 2008 Ventro-lateral prefrontal activity during working memory is modulated by MAO A genetic variation.
18270970 2008 Worldwide genetic variation in dopamine and serotonin pathway genes: implications for association studies.
18261931 2008 Genetically dependent modulation of serotonergic inactivation in the human prefrontal cortex.
18258310 2008 MAOA and the neurogenetic architecture of human aggression.
18248494 2008 Inhibition of monoamine oxidase A promotes secretory differentiation in basal prostatic epithelial cells.
18239643 2008 Genes implicated in serotonergic and dopaminergic functioning predict BMI categories.
18227761 2008 Lipid levels are associated with a regulatory polymorphism of the monoamine oxidase-A gene promoter (MAOA-uVNTR).
18212819 2008 The VNTR 2 repeat in MAOA and delinquent behavior in adolescence and young adulthood: associations and MAOA promoter activity.
18188752 2008 Interactions between genotype and retrospective ADHD symptoms predict lifetime smoking risk in a sample of young adults.
18092818 2008 Comparison of the structural properties of the active site cavities of human and rat monoamine oxidase A and B in their soluble and membrane-bound forms.
18079067 2008 Genetic evaluation of the serotonergic system in chronic fatigue syndrome.
18075472 2007 The MAOA promoter polymorphism, disruptive behavior disorders, and early onset substance use disorder: gene-environment interaction.
18046979 [Genetic polymorphism of a MAO in mental disorders].
18046978 [Genetic polymorphism of COMT in mental disorders].
18029114 2008 The MAO-A gene, platelet MAO-B activity and psychosocial environment in adolescent female alcohol-related problem behaviour.
18023041 2008 No evidence for interaction between MAOA and childhood adversity for antisocial behavior.
17944104 [Genetic basis of time perception in athletes].
17943028 2007 Association between monoamine oxidase A polymorphisms and anger-related personality traits in Korean women.
17931441 2007 Interactions of child maltreatment and serotonin transporter and monoamine oxidase A polymorphisms: depressive symptomatology among adolescents from low socioeconomic status backgrounds.
17920180 2008 An interaction between the norepinephrine transporter and monoamine oxidase A polymorphisms, and novelty-seeking personality traits in Korean females.
17894408 2008 Meta-study on association between the monoamine oxidase A gene (MAOA) and schizophrenia.
17885758 2008 Which genotype of MAO gene that the patients have are likely to be most susceptible to the symptoms of fibromyalgia?
17885625 2007 Association study of monoamine oxidase and catechol-O-methyltransferase genes with smoking behavior.
17884271 2008 Monoamine oxidase A variant influences antidepressant treatment response in female patients with Major Depression.
17883400 2007 Monoamine oxidase-A modulates apoptotic cell death induced by staurosporine in human neuroblastoma cells.
17868476 2007 Calcium-sensitive regulation of monoamine oxidase-A contributes to the production of peroxyradicals in hippocampal cultures: implications for Alzheimer disease-related pathology.
17728669 2007 Association analysis of 15 polymorphisms within 10 candidate genes for antisocial behavioural traits.
17692293 2007 A promoter polymorphism in the monoamine oxidase A gene is associated with the pineal MAOA activity in Alzheimer's disease patients.
17680543 2007 [Association study of the polymorphisms of monoamine oxidase A genes with schizophrenia].
17657171 2007 Association study of MAO-A and DRD4 genes in schizophrenic patients with aggressive behavior.
17627031 2007 A linkage and family-based association analysis of a potential neurocognitive endophenotype of bipolar disorder.
17592478 2008 Interaction between a functional MAOA locus and childhood sexual abuse predicts alcoholism and antisocial personality disorder in adult women.
17585061 2007 Associations of a regulatory polymorphism of monoamine oxidase-A gene promoter (MAOA-uVNTR) with symptoms of depression and sleep quality.
17563839 2007 Association study between clinical response to rizatriptan and some candidate genes.
17534436 2007 Early trauma and increased risk for physical aggression during adulthood: the moderating role of MAOA genotype.
17519928 2008 Genetic variation in MAOA modulates ventromedial prefrontal circuitry mediating individual differences in human personality.
17476365 2007 Monoamine oxidase-A polymorphisms might modify the association between the dopamine D2 receptor gene and alcohol dependence.
17453062 2007 Convergent genetic modulation of the endocrine stress response involves polymorphic variations of 5-HTT, COMT and MAOA.
17449559 2007 Gene-environment interactions in parkinsonism and Parkinson's disease: the Geoparkinson study.
17440951 2007 Gene-lifecourse interaction for alcohol consumption in adolescence and young adulthood: five monoamine genes.
17429405 2008 A non-additive interaction of a functional MAO-A VNTR and testosterone predicts antisocial behavior.
17427196 2007 Monoamine oxidase A gene polymorphism predicts adolescent outcome of attention-deficit/hyperactivity disorder.
17426915 2007 Monoamine oxidases: activities, genotypes and the shaping of behaviour.
17417058 2007 Monoamine oxidase a gene is associated with borderline personality disorder.
17400359 2007 Adipogenesis-related increase of semicarbazide-sensitive amine oxidase and monoamine oxidase in human adipocytes.
17393061 2007 A link between monoamine oxidase-A and apoptosis in serum deprived human SH-SY5Y neuroblastoma cells.
17340199 2008 Brief report: aggression and stereotypic behavior in males with fragile X syndrome--moderating secondary genes in a "single gene" disorder.
17328795 2007 Association study between the monoamine oxidase A gene and attention deficit hyperactivity disorder in Taiwanese samples.
17298646 2007 The monoamine oxidase A (MAO-A) gene, family function and maltreatment as predictors of destructive behaviour during male adolescent alcohol consumption.
17295220 2007 The importance of stress and genetic variation in human aggression.
17230031 2006 No allele variation of the MAOA gene promoter in male Chinese subjects with attention deficit hyperactivity disorder.
17221847 2007 The influence of four serotonin-related genes on decision-making in suicide attempters.
17220478 2007 Proteomics analysis of the interactome of N-myc downstream regulated gene 1 and its interactions with the androgen response program in prostate cancer cells.
17217235 [Association of functional genes polymorphisms of key enzymes in the metabolism of biogenic amines with paranoid schizophrenia susceptibility and the influence of these polymorphisms on PANSS results in antipsychotic treatment].
17208375 2007 Gene-gene interaction analysis of personality traits in a Japanese population using an electrochemical DNA array chip analysis.
17192957 2007 The MAOA T941G polymorphism and short-term treatment response to mirtazapine and paroxetine in major depression.
17167335 2007 Analysis of monoamine oxidase A promoter polymorphism in mentally retarded individuals.
17141746 2007 Evidence that brain MAO A activity does not correspond to MAO A genotype in healthy male subjects.
17044053 2006 Family-based case-control study of MAOA and MAOB polymorphisms in Parkinson disease.
17034017 2007 Adolescent girls and criminal activity: role of MAOA-LPR genotype and psychosocial factors.
17026953 2006 Serotonin transporter, tryptophan hydroxylase, and monoamine oxidase A gene polymorphisms in premenstrual dysphoric disorder.
17020906 2006 Deficient expression of monoamine oxidase A in the endometrium is associated with implantation failure in women participating as recipients in oocyte donation.
17008143 2006 Childhood maltreatment, subsequent antisocial behavior, and the role of monoamine oxidase A genotype.
17007976 2007 Possible interaction between MAOA and DRD2 genes associated with antisocial alcoholism among Han Chinese men in Taiwan.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16958037 2007 Further evidence of MAO-A gene variants associated with bipolar disorder.
16944667 2006 Genetically increased risk of sleep disruption in Alzheimer's disease.
16930369 2006 A genetic association study of dopamine metabolism-related genes and chronic headache with drug abuse.
16896926 2006 The association of DNA sequence variation at the MAOA genetic locus with quantitative behavioural traits in normal males.
16894395 2006 The analysis of 51 genes in DSM-IV combined type attention deficit hyperactivity disorder: association signals in DRD4, DAT1 and 16 other genes.
16893905 2006 Allelic mRNA expression of X-linked monoamine oxidase a (MAOA) in human brain: dissection of epigenetic and genetic factors.
16890910 2006 Monoallelic expression of MAOA in skin fibroblasts.
16856146 2006 MAOA promoter polymorphism and attention deficit hyperactivity disorder (ADHD) in indian children.
16848906 2006 Genetic polymorphisms in monoamine neurotransmitter systems show only weak association with acute post-surgical pain in humans.
16829576 2006 Monoamine oxidase A and repressor R1 are involved in apoptotic signaling pathway.
16814261 2006 MAOA and the "cycle of violence:" childhood abuse and neglect, MAOA genotype, and risk for violent and antisocial behavior.
16806099 2007 Candidate gene polymorphisms in the serotonergic pathway: influence on depression symptomatology in an elderly population.
16801953 2006 MAOA, maltreatment, and gene-environment interaction predicting children's mental health: new evidence and a meta-analysis.
16770335 2006 A functional polymorphism in the MAOA gene promoter (MAOA-LPR) predicts central dopamine function and body mass index.
16763378 2006 A functional polymorphism in the promoter region of the monoamine oxidase A gene is associated with the cigarette smoking quantity in alcohol-dependent heavy smokers.
16741202 2006 Interaction between MAO-A genotype and maltreatment in the risk for conduct disorder: failure to confirm in adolescent patients.
16728402 2006 Glucocorticoid and androgen activation of monoamine oxidase A is regulated differently by R1 and Sp1.
16725119 2006 Gene-gene interaction between MAOA and COMT in suicidal behavior: analysis in schizophrenia.
16674552 2006 Obesity is associated with genetic variants that alter dopamine availability.
16610949 2006 Polymorphisms in genes regulating the HPA axis associated with empirically delineated classes of unexplained chronic fatigue.
16584839 2006 An association study of catechol-O-methyltransferase and monoamine oxidase A polymorphisms and personality traits in Koreans.
16547693 2007 The association between fibromyalgia and polymorphism of monoamine oxidase A and interleukin-4.
16538182 2006 Interaction of serotonergic and noradrenergic gene variants in panic disorder.
16538181 2006 Monoamine oxidase A gene promoter polymorphism affects novelty seeking and reward dependence in healthy study participants.
16526025 2006 MAOA-uVNTR polymorphism in a Brazilian sample: further support for the association with impulsive behaviors and alcohol dependence.
16360899 2006 Combined analysis of association between personality traits and three functional polymorphisms in the tyrosine hydroxylase, monoamine oxidase A, and catechol-O-methyltransferase genes.
16319504 2006 Temperament and character in mood disorders: influence of DRD4, SERTPR, TPH and MAO-A polymorphisms.
16272956 2005 CYP2A6, MAOA, DBH, DRD4, and 5HT2A genotypes, smoking behaviour and cotinine levels in 1518 UK adolescents.
16207390 2006 Association between monoamine oxidase gene polymorphisms and smoking behaviour in Chinese males.
16202396 2006 Monoamine oxidase-a genetic variations influence brain activity associated with inhibitory control: new insight into the neural correlates of impulsivity.
16186632 2005 Monoamine oxidase a polymorphism in Brazilian patients: risk factor for late-onset Alzheimer's disease?
16174289 2005 MAOA haplotypes associated with thrombocyte-MAO activity.
16139427 2005 No association between monoamine oxidase A promoter polymorphism and personality traits in Japanese females.
16129825 2005 Three-dimensional structure of human monoamine oxidase A (MAO A): relation to the structures of rat MAO A and human MAO B.
16125147 2006 Role of monoamine oxidase A genotype and psychosocial factors in male adolescent criminal activity.
16110245 2005 Association study of a functional MAOA-uVNTR gene polymorphism and personality traits in Chinese young females.
16094253 2005 The monoamine oxidase A gene may influence the means used in suicide attempts.
15990460 2005 Association study of a functional MAOA-uVNTR gene polymorphism and cognitive function in healthy females.
15956990 2005 Association study of a monoamine oxidase a gene promoter polymorphism with major depressive disorder and antidepressant response.
15936529 2005 Gene-gene interaction between MAOA and COMT in suicidal behavior.
15900229 2005 Association of MAO A polymorphism and alcoholism in Brazilian females.
15870836 2005 Cluster B personality disorders are associated with allelic variation of monoamine oxidase A activity.
15806601 2005 Monoamine oxidase A (MAOA) and antisocial behaviors in the presence of childhood and adolescent maltreatment.
15772651 2005 The DNA sequence of the human X chromosome.
15722955 2005 Telomeric length varies with age and polymorphisms of the MAOA gene promoter in peripheral blood cells obtained from a community in Taiwan.
15694196 2005 Monoamine oxidases A and B gene polymorphisms in migraine patients.
15670397 2005 Associations between serotonin-related gene polymorphisms and panic disorder.
15635592 2005 Serotonin transporter promoter polymorphism and monoamine oxidase type A VNTR allelic variants together influence alcohol binge drinking risk in young women.
15564894 2004 Association analysis between a functional polymorphism in the monoamine oxidase A gene promoter and severe mood disorders.
15556933 2005 A stable tyrosyl radical in monoamine oxidase A.
15539858 2004 Association analysis for MAOA gene polymorphism with long-latency auditory evoked potentials in healthy females.
15523490 2005 Epistatic interaction between the monoamine oxidase A and serotonin transporter genes in anorexia nervosa.
15498245 2004 [Association between the functional monoamine oxidase A gene polymorphism and aggressively driving behavior].
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15486489 2004 MAO-A gene polymorphisms are associated with major depression and sleep disturbance in males.
15457497 2005 Relationship of MAO-A promoter (u-VNTR) and COMT (V158M) gene polymorphisms to CSF monoamine metabolites levels in a psychiatric sample of caucasians: A preliminary report.
15450911 2004 Association studies of MAO-A, COMT, and 5-HTT genes polymorphisms in patients with anxiety disorders of the phobic spectrum.
15349769 2004 Positive selection in MAOA gene is human exclusive: determination of the putative amino acid change selected in the human lineage.
15346539 2004 Association between serotonin-related genetic polymorphisms and CCK-4-induced panic attacks with or without 5-hydroxytryptophan pretreatment in healthy volunteers.
15341275 2004 [Polymorphism of the serotonin system genes in some Finno-Ugric populations].
15292674 2004 Polymorphisms in the serotonin transporter and monoamine oxidase A genes and their relationship to personality traits measured by the Temperament and Character Inventory and NEO Five-Factor Inventory in healthy volunteers.
15261699 2004 Polymorphisms of dopamine degradation enzyme (COMT and MAO) genes and tardive dyskinesia in patients with schizophrenia.
15241435 2004 Gene-environment interaction analysis of serotonin system markers with adolescent depression.
15211623 2004 Polymorphisms in the MAOA, MAOB, and COMT genes and aggressive behavior in schizophrenia.
15150530 2004 An association between a functional polymorphism in the monoamine oxidase a gene promoter, impulsive traits and early abuse experiences.
15094788 2004 Tourette syndrome and dopaminergic genes: a family-based association study in the French Canadian founder population.
15088154 2004 Analysis of monoamine oxidase A (MAO-A) promoter polymorphism in male heroin-dependent subjects: behavioural and personality correlates.
15088153 2004 Association analysis of the functional monoamine oxidase A gene promotor polymorphism in migraine.
15052272 2004 Investigation of serotonin-related genes in antidepressant response.
15034227 2004 Family-based association study between the monoamine oxidase A gene and obesity: implications for psychopharmacogenetic studies.
15024395 2004 MAOA and persistent, pervasive childhood aggression.
14962671 2004 Association of variations in monoamine oxidases A and B with Parkinson's disease subgroups.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14697881 2004 The FAD binding sites of human monoamine oxidases A and B.
14520117 2003 Catechol-O-methyltransferase and monoamine oxidase A genotypes and drug response to conventional neuroleptics in schizophrenia.
12919132 2003 Association of autism severity with a monoamine oxidase A functional polymorphism.
12886034 2003 Monoamine oxidase A gene polymorphism, 5-HT 2A receptor gene polymorphism and incidence of nausea induced by fluvoxamine.
12877392 2003 Deliberate self-harm is associated with allelic variation in the tryptophan hydroxylase gene (TPH A779C), but not with polymorphisms in five other serotonergic genes.
12824808 2003 Neither antisocial personality disorder nor antisocial alcoholism is associated with the MAO-A gene in Han Chinese males.
12815746 2003 Association analysis of MAOA and COMT with neuroticism assessed by peers.
12778446 2003 [Relationship between the Fnu4HI site polymorphism of monoamine oxidase A gene and Parkinson's disease].
12777388 2003 Structural comparison of human monoamine oxidases A and B: mass spectrometry monitoring of cysteine reactivities.
12773616 2003 Mapping the genetic variation of executive attention onto brain activity.
12668354 2003 Relation of shyness in grade school children to the genotype for the long form of the serotonin transporter promoter region polymorphism.
12650952 2003 Investigating the role of dopaminergic and serotonergic candidate genes in obsessive-compulsive disorder.
12648733 2003 Association between a promoter variant in the monoamine oxidase A gene and schizophrenia.
12629534 2003 Serotonin-related gene polymorphisms and central nervous system serotonin function.
12607224 2000 Polymorphic MAO-A and 5-HT-transporter genes: analysis of interactions in panic disorder.
12566936 2002 A regulatory monoamine oxidase a promoter polymorphism and personality traits.
12563176 2003 Monoamine oxidase polymorphisms and smoking behaviour in Japanese.
12555234 2003 Functional variation in promoter region of monoamine oxidase A and subtypes of alcoholism: haplotype analysis.
12555227 2003 Association of a MAOA gene variant with generalized anxiety disorder, but not with panic disorder or major depression.
12554604 No association between a polymorphism in the promoter region of the MAOA gene with antisocial personality traits in alcoholics.
12502014 2002 Monoamine oxidase: A gene polymorphism, tryptophan hydroxylase gene polymorphism and antidepressant response to fluvoxamine in Japanese patients with major depressive disorder.
12497620 2003 Association analysis of monoamine oxidase A and attention deficit hyperactivity disorder.
12497608 2003 Early-onset schizophrenia and dopamine-related gene polymorphism.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12445480 2002 Inhibitors alter the spectrum and redox properties of monoamine oxidase A.
12428723 2002 Gender difference in the interaction of smoking and monoamine oxidase B intron 13 genotype in Parkinson's disease.
12399942 2002 Concurrent positive association between pathological gambling and functional DNA polymorphisms at the MAO-A and the 5-HT transporter genes.
12360111 2002 Polymorphisms in dopamine metabolic enzymes and tobacco consumption in smokers: seeking confirmation of the association in a follow-up study.
12170473 2002 [The EcoR V polymorphism of human monoamine oxidase A is not associated with idiopathic Parkinson's disease in a Shanghai Han population].
12164325 2002 Genotype frequencies of 50 polymorphisms for 241 Japanese non-cancer patients.
12163988 2002 Moclobemide response in depressed patients: association study with a functional polymorphism in the monoamine oxidase A promoter.
12151768 2002 High activity-related allele of MAO-A gene associated with depressed suicide in males.
12140786 2002 Family-based and association studies of monoamine oxidase A and attention deficit hyperactivity disorder (ADHD): preferential transmission of the long promoter-region repeat and its association with impaired performance on a continuous performance test (TOVA).
12136060 2002 Evidence for a genetic association between monoamine oxidase A and restless legs syndrome.
12116182 2002 Schizophrenia and functional polymorphisms in the MAOA and COMT genes: no evidence for association or epistasis.
12098640 2002 Association of monoamine oxidase A gene polymorphism with Alzheimer's disease and Lewy body variant.
11999895 2002 No association of the MAOA gene with alcoholism among Han Chinese males in Taiwan.
11992560 2002 Association study of MAO-A, COMT, 5-HT2A, DRD2, and DRD4 polymorphisms with illness time course in mood disorders.
11992559 2002 Pharmacogenetics of lithium prophylaxis in mood disorders: analysis of COMT, MAO-A, and Gbeta3 variants.
11992558 2002 Family-based association study of 5-HTTLPR, TPH, MAO-A, and DRD4 polymorphisms in mood disorders.
11963571 2002 [Investigation of monoamine oxidase gene restriction polymorphism in male populations of the Volga-Ural region].
11945082 Monoamine oxidase expression and activity in human placentae from pre-eclamptic and normotensive pregnancies.
11927135 2002 Analysis of monoamine oxidase A (MAOA) promoter polymorphism in Finnish male alcoholics.
11920860 2002 No evidence of an association between a functional monoamine oxidase a gene polymorphism and completed suicides.
11861643 2002 Analysis of conserved active site residues in monoamine oxidase A and B and their three-dimensional molecular modeling.
11812236 2002 High-level expression of human liver monoamine oxidase A in Pichia pastoris: comparison with the enzyme expressed in Saccharomyces cerevisiae.
11761322 2001 Substrates but not inhibitors alter the redox potentials of monoamine oxidases.
11443519 2001 MAO-A and COMT polymorphisms and gene effects in narcolepsy.
11353450 2001 Additional evidence that genetic variation of MAO-A gene supports a gender subtype in obsessive-compulsive disorder.
11304831 2001 Association analysis of the functional monoamine oxidase A gene promoter polymorphism in psychiatric disorders.
11140838 2000 A multivariate analysis of 59 candidate genes in personality traits: the temperament and character inventory.
11121185 2000 Association between a functional polymorphism in the monoamine oxidase A gene promoter and major depressive disorder.
10647887 1999 Association between monoamine oxidase A activity in human male skin fibroblasts and genotype of the MAOA promoter-associated variable number tandem repeat.
9799080 1998 A functional polymorphism in the monoamine oxidase A gene promoter.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8678123 1996 Mutational analysis of the human MAOA gene.
8584674 1995 The promoter of the human monoamine oxidase A gene.
8503438 1993 X-linked borderline mental retardation with prominent behavioral disturbance: phenotype, genetic localization, and evidence for disturbed monoamine metabolism.
8316221 1993 Site-directed mutagenesis of monoamine oxidase A and B: role of cysteines.
8211186 1993 Abnormal behavior associated with a point mutation in the structural gene for monoamine oxidase A.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7519662 1994 A new look at the promoter of the human monoamine oxidase A gene: mapping transcription initiation sites and capacity to drive luciferase expression.
7063850 1982 Human liver MAO-A and MAO-B separated by immunoaffinity chromatography with MAO-B-specific monoclonal antibody.
6788990 1981 Studies on beta-phenylethylamine deamination by human placental monoamine oxidase.
6408492 1983 The deamination of dopamine by human brain monoamine oxidase. Specificity for the two enzyme forms in seven brain regions.
3540317 1986 Assignment of genes for human monoamine oxidases A and B to the X chromosome.
3418353 1988 Structural features of human monoamine oxidase A elucidated from cDNA and peptide sequences.
3387449 1988 cDNA cloning of human liver monoamine oxidase A and B: molecular basis of differences in enzymatic properties.
3178846 1988 Partial amino acid sequence analysis of human placenta monoamine oxidase A and bovine liver monoamine oxidase B.
2906043 1988 Human monoamine oxidase gene (MAOA): chromosome position (Xp21-p11) and DNA polymorphism.
2793188 1989 Localization of human monoamine oxidase-A gene to Xp11.23-11.4 by in situ hybridization: implications for Norrie disease.
2764901 1989 Monoamine oxidase A from human placenta and monoamine oxidase B from bovine liver both have one FAD per subunit.
2744764 1989 Human monoamine oxidase A and B genes map to Xp 11.23 and are deleted in a patient with Norrie disease.
2483108 1989 Monoamine oxidase deficiency in males with an X chromosome deletion.
2414414 1985 Immunological uniqueness of human monoamine oxidases A and B: new evidence from studies with monoclonal antibodies to human monoamine oxidase A.
2023912 1991 Human monoamine oxidase A and B genes exhibit identical exon-intron organization.
2021654 1991 Kinetic mechanism of monoamine oxidase A.
1886775 1991 Structure of the human gene for monoamine oxidase type A.
1783405 1991 Genetic and physical mapping around the properdin P gene.
1578281 1992 Quantitative enzyme radioautography with 3H-Ro 41-1049 and 3H-Ro 19-6327 in vitro: localization and abundance of MAO-A and MAO-B in rat CNS, peripheral organs, and human brain.
1546132 1992 Mode of action and characteristics of monoamine oxidase-A inhibition by moclobemide.
1432104 1992 Promoter organization and activity of human monoamine oxidase (MAO) A and B genes.