Property Summary

NCBI Gene PubMed Count 10
PubMed Score 170.68
PubTator Score 102.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
astrocytoma 2.200 3.8e-02
atypical teratoid / rhabdoid tumor -1.700 1.1e-03
Breast cancer -1.100 3.9e-02
Common variable immunodeficiency -1.562 2.5e-03
cystic fibrosis -1.200 1.7e-03
fibroadenoma -1.400 2.6e-03
glioblastoma 1.600 4.8e-02
group 3 medulloblastoma -2.000 4.1e-05
intraductal papillary-mucinous adenoma (... -1.400 1.1e-03
intraductal papillary-mucinous carcinoma... -1.500 2.8e-03
intraductal papillary-mucinous neoplasm ... -1.900 2.6e-03
lung adenocarcinoma -1.400 2.0e-08
lung cancer -1.300 6.7e-03
medulloblastoma, large-cell -1.700 6.9e-04
nephrosclerosis -1.030 1.5e-02
non-small cell lung cancer -1.244 5.6e-13
oligodendroglioma -1.600 1.6e-02
osteosarcoma -1.575 1.4e-02
ovarian cancer -1.100 2.8e-06
pancreatic ductal adenocarcinoma liver m... -1.942 3.0e-03
primitive neuroectodermal tumor -1.300 1.0e-03
psoriasis -1.500 1.5e-04
tuberculosis and treatment for 6 months -1.100 2.4e-02

Gene RIF (20)

AA Sequence

MLMRKVPGFVPASPWGLRLPQKFLFLLFLSGLVTLCFGALFLLPHSSRLKRLFLAPRTQQPGLEVVAEIA      1 - 70
GHAPAREQEPPPNPAPAAPAPGEDDPSSWASPRRRKGGLRRTRPTGPREEATAARGNSIPASRPGDEGVP     71 - 140
FRFDFNAFRSRLRHPVLGTRADESQEPQSQVRAQREKIKEMMQFAWQSYKRYAMGKNELRPLTKDGYEGN    141 - 210
MFGGLSGATVIDSLDTLYLMELKEEFQEAKAWVGESFHLNVSGEASLFEVNIRYIGGLLSAFYLTGEEVF    211 - 280
RIKAIRLGEKLLPAFNTPTGIPKGVVSFKSGNWGWATAGSSSILAEFGSLHLEFLHLTELSGNQVFAEKV    281 - 350
RNIRKVLRKIEKPFGLYPNFLSPVSGNWVQHHVSVGGLGDSFYEYLIKSWLMSGKTDMEAKNMYYEALEA    351 - 420
IETYLLNVSPGGLTYIAEWRGGILDHKMGHLACFSGGMIALGAEDAKEEKRAHYRELAAQITKTCHESYA    421 - 490
RSDTKLGPEAFWFNSGREAVATQLSESYYILRPEVVESYMYLWRQTHNPIYREWGWEVVLALEKYCRTEA    491 - 560
GFSGIQDVYSSTPNHDNKQQSFFLAETLKYLYLLFSEDDLLSLEDWVFNTEAHPLPVNHSDSSGRAWGRH    561 - 630
//

Text Mined References (12)

PMID Year Title