Property Summary

NCBI Gene PubMed Count 18
PubMed Score 7.57
PubTator Score 7.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 2.6e-02
Breast cancer -1.100 1.8e-04
group 3 medulloblastoma 2.600 1.3e-03
interstitial cystitis -1.200 1.7e-03
lung carcinoma 1.200 9.7e-24
medulloblastoma, large-cell 2.100 2.3e-03
osteosarcoma -1.255 1.5e-02
ovarian cancer -2.600 4.7e-09
pancreatic ductal adenocarcinoma liver m... -1.206 5.9e-03
pituitary cancer -1.800 1.9e-03
tuberculosis 1.500 2.2e-05
ulcerative colitis -1.300 1.7e-06

Protein-protein Interaction (4)

Gene RIF (8)

AA Sequence

MGDFAAPAAAANGSSICINSSLNSSLGGAGIGVNNTPNSTPAAPSSNHPAAGGCGGSGGPGGGSAAVPKH      1 - 70
STVVERLRQRIEGCRRHHVNCENRYQQAQVEQLELERRDTVSLYQRTLEQRAKKSGAGTGKQQHPSKPQQ     71 - 140
DAEAASAEQRNHTLIMLQETVKRKLEGARSPLNGDQQNGACDGNFSPTSKRIRKDISAGMEAINNLPSNM    141 - 210
PLPSASPLHQLDLKPSLPLQNSGTHTPGLLEDLSKNGRLPEIKLPVNGCSDLEDSFTILQSKDLKQEPLD    211 - 280
DPTCIDTSETSLSNQNKLFSDINLNDQEWQELIDELANTVPEDDIQDLFNEDFEEKKEPEFSQPATETPL    281 - 350
SQESASVKSDPSHSPFAHVSMGSPQARPSSSGPPFSTVSTATSLPSVASTPAAPNPASSPANCAVQSPQT    351 - 420
PNQAHTPGQAPPRPGNGYLLNPAAVTVAGSASGPVAVPSSDMSPAEQLKQMAAQQQQRAKLMQQKQQQQQ    421 - 490
QQQQQQQQQQQQQQQQQQQQHSNQTSNWSPLGPPSSPYGAAFTAEKPNSPMMYPQAFNNQNPIVPPMANN    491 - 560
LQKTTMNNYLPQNHMNMINQQPNNLGTNSLNKQHNILTYGNTKPLTHFNADLSQRMTPPVANPNKNPLMP    561 - 630
YIQQQQQQQQQQQQQQQQQQPPPPQLQAPRAHLSEDQKRLLLMKQKGVMNQPMAYAALPSHGQEQHPVGL    631 - 700
PRTTGPMQSSVPPGSGGMVSGASPAGPGFLGSQPQAAIMKQMLIDQRAQLIEQQKQQFLREQRQQQQQQQ    701 - 770
QQILAEQQLQQSHLPRQHLQPQRNPYPVQQVNQFQGSPQDIAAVRSQAALQSMRTSRLMAQNAGMMGIGP    771 - 840
SQNPGTMATAAAQSEMGLAPYSTTPTSQPGMYNMSTGMTQMLQHPNQSGMSITHNQAQGPRQPASGQGVG    841 - 910
MVSGFGQSMLVNSAITQQHPQMKGPVGQALPRPQAPPRLQSLMGTVQQGAQSWQQRSLQGMPGRTSGELG    911 - 980
PFNNGASYPLQAGQPRLTKQHFPQGLSQSVVDANTGTVRTLNPAAMGRQMMPSLPGQQGTSQARPMVMSG    981 - 1050
LSQGVPGMPAFSQPPAQQQIPSGSFAPSSQSQAYERNAPQDVSYNYSGDGAGGSFPGLPDGADLVDSIIK   1051 - 1120
GGPGDEWMQELDELFGNP                                                       1121 - 1138
//

Text Mined References (21)

PMID Year Title