Property Summary

NCBI Gene PubMed Count 52
PubMed Score 61.84
PubTator Score 66.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (22)

Disease log2 FC p
astrocytoma 2.600 5.6e-35
ependymoma 2.300 2.8e-02
oligodendroglioma 2.500 2.2e-20
glioblastoma multiforme 1.900 3.3e-24
atypical teratoid / rhabdoid tumor 1.800 1.1e-04
medulloblastoma, large-cell 1.300 1.2e-03
primitive neuroectodermal tumor 1.500 2.4e-02
autosomal dominant Emery-Dreifuss muscul... 1.167 1.0e-03
juvenile dermatomyositis 1.291 1.6e-12
primary pancreatic ductal adenocarcinoma 1.388 5.5e-04
Breast cancer -4.200 1.6e-22
adult high grade glioma 1.900 6.5e-04
group 3 medulloblastoma 2.400 9.8e-04
pilocytic astrocytoma 2.000 2.4e-06
aldosterone-producing adenoma -1.053 2.4e-02
psoriasis -1.600 4.5e-12
breast carcinoma -1.900 9.8e-45
Pick disease 1.700 6.7e-04
ductal carcinoma in situ -1.500 2.4e-03
invasive ductal carcinoma -1.900 2.5e-03
ovarian cancer 1.700 2.1e-05
pancreatic cancer 1.500 4.6e-04

Protein-protein Interaction (11)

Gene RIF (39)

PMID Text
26796488 Detection of the CRTC1/MAML2 fusion transcript provides useful information for MEC diagnosis but is not associated with differences in survival outcomes.
26503699 The molecular basis underlying CRTC1-MAML2 oncogenic functions were identified in mucoepidermoid carcinoma cells.
25953768 SNPs in Notch pathway genes may be predictors of cutaneous melanoma disease-specific survival.
25123064 We identified MAML2 rearrangements in five of nine odontogenic cysts lined by mucus-secreting cells
25071166 Malignant mucoepidermoid salivary gland tumors can arise from a recurrent t (11, 19)(q21;p13.1) translocation that generates an unusual chimeric CRTC1/MAML2 oncoprotein.
24855209 The rearrangement between MAML2 and CXCR4, created by a t(2;11)(q22.1;q21) translocation, results in a new fusion gene in which a portion of CXCR4 is linked to the MAML2 gene.
24771140 Translocation t(11;19)(q14-21;p12-13) in patients with Salivary mucoepidermoid carcinoma was reported , which results in fusion between exons 1 and 2 of MAML2 on chromosome 11q21.Fusion positive, MAML2 re-arrangements are present in 50-70 % of MECs.
24714697 MAML2 rearrangement appears frequent in PMEC and specific with this tumor. Both the presence of MAML2 rearrangement and absence of FLT1 tend to confer a favorable clinical outcome.
24647913 The high sensitivity and specificity of MAML2 rearrangement for central mucoepidermoid carcinoma points to its utility as a diagnostic adjunct in separating mucinous cystic lesions of the gnathic bones.
24468654 Lacrimal and salivary gland PAs and Ca-ex-PAs have similar genomic profiles and frequently overexpress the PLAG1 oncoprotein. Copy number gains involving 9p23-p22.3 (NFIB) and 22q12-qter (PDGFB) may be of importance for disease progression.
24134933 using FISH to identify MAML2 rearrangement is a valuable diagnostic tool in the evaluation of thymic malignancies, specifically, distinguishing mucoepidermoid carcinoma from squamous cell carcinoma and adenosquamous carcinoma.
24121173 Metaplastic Warthin tumor and metaplastic pleomorphic adenoma of salivary glands did not harbor CRTC1-MAML2 and CRTC3-MAML2 fusion transcripts, respectively, or MAML2 gene rearrangement.
23975434 aberrantly activated AREG-EGFR signaling is required for CRTC1-MAML2-positive MEC cell growth and survival, suggesting that EGFR-targeted therapies will benefit patients with advanced, unresectable CRTC1-MAML2-positive MEC.
23855785 high-grade salivary mucoepidermoid carcinoma comprises a heterogeneous group of tumours in terms of molecular pathogenesis, in particular MAML2 fusion status
23333304 HIV-1 Vif downregulates the expression of mastermind-like 2 (MAML2) in Vif-expression T cells
23035786 The presence of the MAML2 gene split defines a distinct mucoepidermoid carcinoma subset that is associated clinicopathologically with favorable tumor features.
22833306 The lack of significant correlation with histologic grade or pathologic stage implies that the previously reported prognostic value of the MAML2 translocation may be an artifact of misclassification of MEC as other tumors.
22582766 presence of small subpopulation of cells carrying MAML2 rearrangement in areas of squamous metaplasia in WT could predispose lesions to malignant transformation in mucoepidermoid carcinoma and could represent molecular link between the 2 entities.
21777943 The presence of MAML2 rearrangement can be used as supportive evidence to distinguish oncocytic mucoepidermoid carcinoma from other oncocytic lesions.
21668476 mucoepidermoid carcinoma of the salivary glands positive for CRTC1-MAML2 or CRTC3-MAML2 fusion formed a favourable tumour subset that was distinct from fusion-negative cases
21119597 in line with the essential role of MAML proteins for assembly and activity of the NOTCH transcriptional complex (NTC), we show that MAML-derived small-peptide constructs block NOTCH activity and disrupt NTC formation in vitro
21074686 The t(11;19) translocation and its CRTC1/MAML1 fusion transcript have been identified in mucoepidermoid carcinomas at different sites and are believed to be associated with the development of a subset of these tumors.
20625861 We report an example of intraosseous mucoepidermoid carcinoma with positive TORC1/MAML2 gene fusion transcript and discuss the clinical implications.
20588178 MECT1/MAML2 translocation status may be important prognostically in salivary mucoepidermoid carcinomas, but it does not seem to override traditional clinicopathologic parameters.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19749740 Mucoepidermoid carcinomas possessing CRTC3-MAML2 fusion may be associated with favorable clinicopathological features and patients may be younger than those with CRTC1-MAML2 fusion or those with no detectable gene fusion.
19531414 CRTC1-MAML2 fusion was associated with favorable clinicopathologic tumor features and was useful in predicting the overall survival of patients with salivary gland mucoepidermoid carcinoma
19521953 Mucoepidermoid carcinomas are often characterized by the fusion gene CRTC1-MAML2. The mean expression level of an embryonic stem cell marker, HMGA2 was studied and found to be higher in fusion negative than in positive tumors.
19269006 MAML2 and MECT1 fusion product can be detected by fluorescence in situ hybridization and reverse transcriptase polymerase chain reaction analysis performed on low- and high-grade primary bronchopulmonary mucoepidermoid carcinoma
19240061 Observational study of gene-disease association. (HuGE Navigator)
18206539 The presence of the t(11;19)(q21;p13) rearrangement favors a diagnosis of mucoepidermoid carcinoma.
18050304 study reports for the first time a CRTC3-MAML2 fusion gene in a mucoepidermoid carcinoma, as determined by RT-PCR and sequencing.
17551948 MAML2 involving a chimeric gene might contribute to carcinogenesis in multiple neoplasms by the disruption of NOTCH signaling.
17437281 CRTC1/MAML2 transcript may be detected in both low and high grade mucoepidermoid carcinoma (MEC), that fusion negative tumors may define a subset of biologically aggressive MEC's tumors
17334997 The present and previous observations indicate that the CRTC1-MAML2 fusion is etiologically linked to benign and low-grade malignant tumors originating from diverse exocrine glands rather than being linked to a separate tumor entity.
16818685 The MECT1-MAML2 fusion transcript may be specific to mucoepidermoid carcinoma and associated with a distinct mucoepidermoid carcinoma subset that exhibits favorable clinicopathologic features and an indolent clinical course.
14720503 cloning of a novel fusion gene in mucoepidermoid carcinomas & benign Warthin's tumors; the fusion, which results from a translocation, creates a chimeric gene in which exon 1 of a novel gene designated WAMTP1 is linked to exons 2-5 of MAML2 [WAMPT1]
12539049 cloning and functional analyses of the t(11;19) fusion oncogene t(11;19)(q21;p13) translocation in mucoepidermoid carcinoma creates a novel fusion product that disrupts a Notch signaling pathway.
12386158 Identification of new human proteins defines a family that consists of positive regulators for notch signaling

AA Sequence

MGDTAPPQAPAGGLGGASGAGLLGGGSVTPRVHSAIVERLRARIAVCRQHHLSCEGRYERGRAESSDRER      1 - 70
ESTLQLLSLVQHGQGARKAGKHTKATATAATTTAPPPPPAAPPAASQAAATAAPPPPPDYHHHHQQHLLN     71 - 140
SSNNGGSGGINGEQQPPASTPGDQRNSALIALQGSLKRKQVVNLSPANSKRPNGFVDNSFLDIKRIRVGE    141 - 210
NLSAGQGGLQINNGQSQIMSGTLPMSQAPLRKTNTLPSHTHSPGNGLFNMGLKEVKKEPGETLSCSKHMD    211 - 280
GQMTQENIFPNRYGDDPGEQLMDPELQELFNELTNISVPPMSDLELENMINATIKQDDPFNIDLGQQSQR    281 - 350
STPRPSLPMEKIVIKSEYSPGLTQGPSGSPQLRPPSAGPAFSMANSALSTSSPIPSVPQSQAQPQTGSGA    351 - 420
SRALPSWQEVSHAQQLKQIAANRQQHARMQQHQQQHQPTNWSALPSSAGPSPGPFGQEKIPSPSFGQQTF    421 - 490
SPQSSPMPGVAGGSGQSKVMANYMYKAGPSAQGGHLDVLMQQKPQDLSRSFINNPHPAMEPRQGNTKPLF    491 - 560
HFNSDQANQQMPSVLPSQNKPSLLHYTQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQSSISAQQQQ    561 - 630
QQQSSISAQQQQQQQQQQQQQQQQQQQQQQQQQQQPSSQPAQSLPSQPLLRSPLPLQQKLLLQQMQNQPI    631 - 700
AGMGYQVSQQQRQDQHSVVGQNTGPSPSPNPCSNPNTGSGYMNSQQSLLNQQLMGKKQTLQRQIMEQKQQ    701 - 770
LLLQQQMLADAEKIAPQDQINRHLSRPPPDYKDQRRNVGNMQPTAQYSGGSSTISLNSNQALANPVSTHT    771 - 840
ILTPNSSLLSTSHGTRMPSLSTAVQNMGMYGNLPCNQPNTYSVTSGMNQLTQQRNPKQLLANQNNPMMPR    841 - 910
PPTLGPSNNNNVATFGAGSVGNSQQLRPNLTHSMASMPPQRTSNVMITSNTTAPNWASQEGTSKQQEALT    911 - 980
SAGVRFPTGTPAAYTPNQSLQQAVGSQQFSQRAVAPPNQLTPAVQMRPMNQMSQTLNGQTMGPLRGLNLR    981 - 1050
PNQLSTQILPNLNQSGTGLNQSRTGINQPPSLTPSNFPSPNQSSRAFQGTDHSSDLAFDFLSQQNDNMGP   1051 - 1120
ALNSDADFIDSLLKTEPGNDDWMKDINLDEILGNNS                                     1121 - 1156
//

Text Mined References (56)

PMID Year Title
26796488 2016 Role of CRTC1/MAML2 Translocation in the Prognosis and Clinical Outcomes of Mucoepidermoid Carcinoma.
26503699 2015 Gene expression profiling analysis of CRTC1-MAML2 fusion oncogene-induced transcriptional program in human mucoepidermoid carcinoma cells.
25953768 2015 Functional Variants in Notch Pathway Genes NCOR2, NCSTN, and MAML2 Predict Survival of Patients with Cutaneous Melanoma.
25123064 2015 Fluorescence in-situ hybridization identifies Mastermind-like 2 (MAML2) rearrangement in odontogenic cysts with mucous prosoplasia: a pilot study.
25117820 2014 Genetic variant predicts bevacizumab-induced hypertension in ECOG-5103 and ECOG-2100.
25071166 2014 CRTC1/MAML2 gain-of-function interactions with MYC create a gene signature predictive of cancers with CREB-MYC involvement.
24855209 2014 Translocation t(2;11) in CLL cells results in CXCR4/MAML2 fusion oncogene.
24771140 2015 Salivary mucoepidermoid carcinoma revisited.
24714697 2014 MAML2 rearrangement in primary pulmonary mucoepidermoid carcinoma and the correlation with FLT1 expression.
24647913 2014 Glandular odontogenic cysts (GOCs) lack MAML2 rearrangements: a finding to discredit the putative nature of GOC as a precursor to central mucoepidermoid carcinoma.
24468654 2014 Lacrimal gland pleomorphic adenoma and carcinoma ex pleomorphic adenoma: genomic profiles, gene fusions, and clinical characteristics.
24134933 2013 Analysis of MAML2 rearrangement in mucoepidermoid carcinoma of the thymus.
24121173 2013 CRTC1-MAML2 and CRTC3-MAML2 fusions were not detected in metaplastic Warthin tumor and metaplastic pleomorphic adenoma of salivary glands.
23975434 2014 Aberrantly activated AREG-EGFR signaling is required for the growth and survival of CRTC1-MAML2 fusion-positive mucoepidermoid carcinoma cells.
23855785 2013 HER2 and EGFR gene copy number alterations are predominant in high-grade salivary mucoepidermoid carcinoma irrespective of MAML2 fusion status.
23456168 2013 Genome-wide association study in Han Chinese identifies three novel loci for human height.
23322567 2013 Identification of a candidate gene for astigmatism.
23192594 2013 Gene-environment interactions and obesity traits among postmenopausal African-American and Hispanic women in the Women's Health Initiative SHARe Study.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23035786 2013 Clinicopathological significance of MAML2 gene split in mucoepidermoid carcinoma.
22833306 2012 Prospective testing of mucoepidermoid carcinoma for the MAML2 translocation: clinical implications.
22582766 2012 MAML2 rearrangement in Warthin's tumour: a fluorescent in situ hybridisation study of metaplastic variants.
21777943 2011 Fluorescence in situ hybridization for detection of MAML2 rearrangements in oncocytic mucoepidermoid carcinomas: utility as a diagnostic test.
21668476 2011 Impact of CRTC1/3-MAML2 fusions on histological classification and prognosis of mucoepidermoid carcinoma.
21658281 2011 GWAS for discovery and replication of genetic loci associated with sudden cardiac arrest in patients with coronary artery disease.
21119597 2011 High-level expression of Mastermind-like 2 contributes to aberrant activation of the NOTCH signaling pathway in human lymphomas.
21074686 2010 CRTC1/MAML2 fusion transcript in central mucoepidermoid carcinoma of mandible--diagnostic and histogenetic implications.
20625861 2010 Central mucoepidermoid carcinoma, a case report with molecular analysis of the TORC1/MAML2 gene fusion.
20588178 2010 A reappraisal of the MECT1/MAML2 translocation in salivary mucoepidermoid carcinomas.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19749740 2009 Clinicopathological significance of the CRTC3-MAML2 fusion transcript in mucoepidermoid carcinoma.
19531414 2009 Prognostic significance of p27Kip1, Ki-67, and CRTC1-MAML2 fusion transcript in mucoepidermoid carcinoma: a molecular and clinicopathologic study of 101 cases.
19521953 2009 A link between the expression of the stem cell marker HMGA2, grading, and the fusion CRTC1-MAML2 in mucoepidermoid carcinoma.
19269006 2009 Mammalian mastermind like 2 11q21 gene rearrangement in bronchopulmonary mucoepidermoid carcinoma.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19176441 2009 Genome-wide interrogation of germline genetic variation associated with treatment response in childhood acute lymphoblastic leukemia.
18206539 2008 A closer look at Warthin tumors and the t(11;19).
18050304 2008 A new type of MAML2 fusion in mucoepidermoid carcinoma.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17551948 2007 Identification of a novel fusion gene MLL-MAML2 in secondary acute myelogenous leukemia and myelodysplastic syndrome with inv(11)(q21q23).
17437281 2007 CRTC1/MAML2 fusion transcript in high grade mucoepidermoid carcinomas of salivary and thyroid glands and Warthin's tumors: implications for histogenesis and biologic behavior.
17334997 2007 Frequent fusion of the CRTC1 and MAML2 genes in clear cell variants of cutaneous hidradenomas.
16818685 2006 MECT1-MAML2 fusion transcript defines a favorable subset of mucoepidermoid carcinoma.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15961999 2005 Transforming activity of MECT1-MAML2 fusion oncoprotein is mediated by constitutive CREB activation.
15729701 2005 Clear cell hidradenoma of the skin-a third tumor type with a t(11;19)--associated TORC1-MAML2 gene fusion.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14720503 2004 Altered Notch signaling resulting from expression of a WAMTP1-MAML2 gene fusion in mucoepidermoid carcinomas and benign Warthin's tumors.
12539049 2003 t(11;19)(q21;p13) translocation in mucoepidermoid carcinoma creates a novel fusion product that disrupts a Notch signaling pathway.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12386158 2002 Identification of new human mastermind proteins defines a family that consists of positive regulators for notch signaling.
12370315 2002 Identification of a family of mastermind-like transcriptional coactivators for mammalian notch receptors.
11347906 2001 Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.