Property Summary

Ligand Count 10
NCBI Gene PubMed Count 132
PubMed Score 253.95
PubTator Score 234.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
IMMUNODEFICIENCY 12 1 0.0 0.0
Lymphoma, Large B-Cell, Diffuse 34 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Multiple Sclerosis 540 0.0 3.0

Expression

  Differential Expression (13)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.500 4.1e-05
ependymoma 1.100 3.2e-06
gastric carcinoma 1.100 2.8e-02
Gaucher disease type 3 -1.200 1.1e-02
glioblastoma 1.200 4.0e-05
group 3 medulloblastoma 1.100 6.9e-03
lung cancer 3.300 7.5e-04
osteosarcoma -1.538 9.6e-05
ovarian cancer 1.200 4.2e-04
pediatric high grade glioma 1.300 1.6e-04
primitive neuroectodermal tumor 1.200 2.3e-03
psoriasis 1.100 3.2e-07
subependymal giant cell astrocytoma 2.173 3.3e-02

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (98)

AA Sequence

MSLLGDPLQALPPSAAPTGPLLAPPAGATLNRLREPLLRRLSELLDQAPEGRGWRRLAELAGSRGRLRLS      1 - 70
CLDLEQCSLKVLEPEGSPSLCLLKLMGEKGCTVTELSDFLQAMEHTEVLQLLSPPGIKITVNPESKAVLA     71 - 140
GQFVKLCCRATGHPFVQYQWFKMNKEIPNGNTSELIFNAVHVKDAGFYVCRVNNNFTFEFSQWSQLDVCD    141 - 210
IPESFQRSVDGVSESKLQICVEPTSQKLMPGSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYV    211 - 280
DLEHQGTYWCHVYNDRDSQDSKKVEIIIGRTDEAVECTEDELNNLGHPDNKEQTTDQPLAKDKVALLIGN    281 - 350
MNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENF    351 - 420
GNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGY    421 - 490
ATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRAL    491 - 560
TDPIQGTEYSAESLVRNLQWAKAHELPESMCLKFDCGVQIQLGFAAEFSNVMIIYTSIVYKPPEIIMCDA    561 - 630
YVTDFPLDLDIDPKDANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVE    631 - 700
DKQEVNVGKPLIAKLDMHRGLGRKTCFQTCLMSNGPYQSSAATSGGAGHYHSLQDPFHGVYHSHPGNPSN    701 - 770
VTPADSCHCSRTPDAFISSFAHHASCHFSRSNVPVETTDEIPFSFSDRLRISEK                    771 - 824
//

Text Mined References (138)

PMID Year Title