Property Summary

NCBI Gene PubMed Count 120
PubMed Score 241.61
PubTator Score 234.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
psoriasis 1.100 3.2e-07
osteosarcoma -1.538 9.6e-05
ependymoma 1.100 3.2e-06
glioblastoma 1.600 6.4e-04
medulloblastoma 1.500 2.4e-05
atypical teratoid / rhabdoid tumor 1.500 4.1e-05
primitive neuroectodermal tumor 1.200 2.3e-03
lung cancer 4.300 9.8e-06
pediatric high grade glioma 1.300 1.6e-04
subependymal giant cell astrocytoma 2.173 3.3e-02
gastric carcinoma 1.100 2.8e-02
ovarian cancer 1.200 4.2e-04
Gaucher disease type 3 -1.200 1.1e-02

Protein-protein Interaction (9)

Gene RIF (89)

PMID Text
27068814 TCR-induced alternative splicing augments MALT1 scaffolding to enhance downstream signalling and to promote optimal T-cell activation.
26788853 Backbone Assignment of the MALT1 Paracaspase by Solution NMR.
26787500 Targeting MALT1 proteolytic activity in autoimmune disease and B-cell lymphoma might not be a successful strategy. (Review)
26767426 MALT1 protease activity has a central role in keratinocyte immunity
26716947 The MALT1 is a key player in the activation of the NF-kappa B upon antigen receptor stimulation and lymphocyte activation.
26668357 Data show that caspase recruitment domain-containing protein 11/B-cell CLL/lymphoma 10/mucosa-associated lymphoid tissue lymphoma translocation gene 1 signaling drives lymphoproliferation through NF-kappa B and c-Jun N-terminal kinase activation.
26573773 The MALT1-mediated HOIL-1 cleavage provides a gain-of-function mechanism that is involved in the negative feedback regulation of NF-kappaB signaling.
26540570 Data show that Bruton tyrosine kinase (BTK)inhibitor Ibrutinib augments MALT lymphoma associated translocation protein (MALT1) inhibition by S-Mepazine in CD79 antigen mutant activated B cell-subtype (ABC) of diffuse large B cell lymphoma (DLBCL).
26525107 By regulating linear ubiquitination, MALT1 is both a positive and negative pleiotropic regulator of the human canonical NF-kappaB pathway.
26507244 An overview of the present understanding of MALT1's function is presented. [review]
26386283 Studies indicate that t(11;18)(q21;q21) translocation involves MALT1 (MALT lymphoma translocation protein 1) gene.
26377317 Comparative analysis of the active site suggests that paracaspases constitute one of the several subclasses of metacaspases that have evolved several times independently.
25996250 MALT1 uses multiple strategies to ensure NF-kappaB activation and target gene expression. (Review)
25982276 MALT1-dependent NF-kappaB activation is crucial for the development of EGFR-associated solid-tumor progression
25748427 data demonstrate that MALT1 ubiquitination is critical for the engagement of CBM and IKK complexes, thereby directing platelet signals to the NF-kappaB pathway.
25569716 API2-MALT1 induces paracaspase-mediated cleavage of the tumour suppressor protein LIMA1.
25502755 The strongest hypermethylation signal in type 2 diabetes mellitus is in the promoter of the MALT1 gene, involved in insulin and glycemic pathways, and related to taurocholate levels in blood.
25500259 MALT1 exerts its effect upon immune response through the initiation of cellular miR-2909 RNomics.
25384343 Overexpression of CARMA-BCL10-MALT in T-ALL may contribute to the constitutive cleavage and inactivation of A20, which enhances NF-kappaB signaling and may be related to T-ALL pathogenesis.
25285878 This is q review of the understanding of MALT1 function and regulation, and the development of small molecule MALT1 inhibitors for therapeutic applications.
25105596 MALT1 auto-proteolysis is essential for NF-kappaB-dependent gene transcription in activated lymphocytes.
24971370 The MALT1 and MALT1-V1 variant expression level was downregulated in rheumatoid arthritis patients.
24332264 Combined immunodeficiency associated with homozygous MALT1 mutations.
24074955 Structure-guided mutagenesis confirmed the observed interfaces in Bcl10 filament assembly and MALT1 activation in vitro and NF-kappaB activation in cells.
24004675 This review highlights the recent advances in the normal and disease-related functions of MALT1
23977204 Glutamate 549 at the dimerization interface is required for the formation of the enzymatically active, monoubiquitinated form of MALT1.
23946259 In the crystal structure of human MALT1casp-Ig3 in complex with the tricyclic phenothiazine derivative thioridazine the inhibitor is bound in a hydrophobic pocket far from the active site.
23799590 Taken together, loss of MALT1 expression alters keratin expression and enhances proliferation of carcinoma cells, and may progress oral carcinomas into the advanced state.
23778523 observations demonstrate MALT1 represses genes activating the aggressive phenotype of carcinoma cells, and MALT1 acts as a tumour suppressor and the loss of expression stimulates oral carcinoma progression
23770847 our study implicates RIP1 ubiquitination as a critical component of API2-MALT1-dependent lymphomagenesis
23416615 monoubiquitination of MALT1 is essential for its catalytic activation and is therefore a potential target for the treatment of ABC-DLBCL and for immunomodulation.
23358872 Overexpression of MALT1 partially rescues HECTD3 depletion-induced apoptosis.
23264041 USP2a plays an important role in TCR signaling by deSUMOylating TRAF6 and mediating TRAF6-MALT1 interaction
23238017 These phenothiazines selectively inhibit cleavage activity of recombinant and cellular MALT1 by a noncompetitive mechanism.
23238016 A selected lead compound, MI-2, featured direct binding to MALT1 and suppression of its protease function.
23018871 Report t(14;18)(q32;q21) involving IGH-MALT1 in extranodal diffuse large B-cell lymphomas of the breast and testis.
22752732 Absence of the carcinoma cell-specific mutation suggests that the inactivation of MALT1 expression but not the mutation promotes oral carcinoma progression
22689981 work establishes a molecular link between MALT lymphoma and ABC-DLBCL, and provides mouse models to test MALT1 inhibitors. Finally, our results suggest that hematopoietic stem/progenitor cells may be involved in the pathogenesis of human B-cell lymphomas
22574776 The catalytic activity of MALT1 promotes activation of canonical and non-canonical NF-kappaB as well as other signalling pathways.
22366302 Authors provide biochemical and structural evidence that MALT1 activation is dependent on its dimerization and show that mutations at the dimer interface abrogate activity in cells.
22309193 MALT1 has many similarities to caspase 8, even cleaving the putative target protein CYLD with comparable efficiencies, but with diametrically opposite primary substrate specificity.
21966355 Data show that the tandem Ig-like domains of MALT1 exists as a mixture of dimer and tetramer in solution.
21873235 a central role for Malt1-dependent RelB cleavage in canonical NF-kappaB activation and thereby provide a rationale for the targeting of Malt1 in immunomodulation and cancer treatment.
21757570 the detection of MALT1 gene rearrangements in BALF cells is useful for the diagnosis of pulmonary MALT lymphoma, as it is a specific method that is less invasive than surgical biopsy.
21448133 MALT1 proteolytic activity plays a role in T-cell receptor-induced JNK activation through cleavage of CYLD protein.
21283787 Thus, dectin-1 and dectin-2 control adaptive T(H)-17 immunity to fungi via Malt1-dependent activation of c-Rel.
21273489 study shows API2-MALT1 fusion oncoprotein induces proteolytic cleavage of NF-kappaB-inducing kinase (NIK); resulting deregulated NIK activity is associated with constitutive noncanonical NF-kappaB signaling, enhanced B cell adhesion and apoptosis resistance
21055028 The presence of 3 copies of bcl-6 and MALT1 genes are the commonest genetic abnormalities observed in ocular MALT lymphomas.
20804738 A20 is cleaved by MALT1 with the realease of the hA20p50 and hA20p37 fragments.
20695076 activation of NF-kappaB by CXCR4 occurs through Carma3/Bcl10/Malt1 (CBM) complex in OSCC. loss of components of CBM complex in HNSCC can inhibit SDF-1 alpha induced phosphorylation and degradation of IkappaBalpha.
20079017 API2-MALT1 fusion gene is a distinctive genetic aberration in MALT lymphomas, and is not present in diffuse large B cell lymphoma.
19965626 The molecular characterization of the IGH-MALT1 fusion products in 5 new cases of t(14;18)-positive mucosa-associated lymphoid tissue lymphomas, is reported.
19897720 Results demonstrate a key role for MALT1 in diffuse large B-cell lymphoma (DLBCL) of the activated B-cell subtype, and provide a rationale for the development of pharmacological inhibitors of MALT1 in DLBCL therapy.
19841089 These results indicate a growth-promoting role for MALT1 paracaspase activity in activated B cell like-diffuse large B cell lymphoma.
19494296 A20 functions as a Malt1 deubiquitinating enzyme and proteasomal degradation and de novo synthesis of A20 contributes to balance T cell receptor/CD28-induced IKK/NF-kappaB signaling
19444310 T-cell activation triggers the recruitment of the COP9 signalosome (CSN) to the Carma1-Bcl10-Malt1 (CBM) complex, and CSN downregulation impairs TCR-induced IKK activation.
19394813 data does not support the hypothesis that germline variations of MALT1 may play a role as genetic risk factors in the development of primary gastric lymphoma.
19394813 Observational study of gene-disease association. (HuGE Navigator)
19279678 data suggest that this inherent instability of MALT1-API2 prevents its accumulation and renders a potential effect on MALT lymphoma development via destabilization of BCL10 unlikely
19234489 TRAF2 interaction is critical for c-IAP2/MALT1-mediated increases in the NF-kappaB activity, increased expression of endogenous NF-kappaB target genes and resistance to apoptosis.
19112107 components of the CBM complex, Carma3, Bcl10, and Malt1 are key mediators of the CXCL8/IL8-induced NFkappaB activation and VEGF up-regulation.
19060847 Methylation and API2/MALT1 fusion in colorectal extranodal marginal zone lymphoma.
18806265 analysis of protein domains that mediate interaction between Bcl10 and MALT1
18691973 Caspase-8 undergoes limited activation upon antigenic stimulation, and this activation is dependent on the paracaspase MALT1.
18625728 Data show that the protein kinase C-responsive inhibitory domain of CARD11 functions in NF-kappaB activation to regulate the association of multiple signaling cofactors that differentially depend on Bcl10 and MALT1 for association.
18367485 chromosome region 18q21 gain including the MALT1 gene is associated with the activated B-cell-like gene expression subtype and increased BCL2 gene dosage and protein expression in diffuse large B-cell lymphoma
18231929 BCL10 and MALT1 might not only reflect the lymphocytic origin of H-RS cells, but autonomous activity of this crippled antigen receptor pathway might confer NFB activity and apoptosis resistance 9 at least in those cases of HL expressing wild-type IB.
17948050 Upon T-cell activation, Malt1 is ubiquitinated, which is critical for the engagement of Carma1-Bcl10-Malt1 and IKK complexes, thereby directing T cell receptor signals to the NF-kappaB pathway.
17894851 careful observation for development of gastric carcinoma and disease progression is essential during follow-up of API2-MALT1-positive MALT lymphoma when patients decline second-line treatment.
17199743 Our results suggest that MALT1-specific translocations and FOXP1 rearrangements are not commonly involved in pathogenesis.
17145608 In vivo data indicate an effect of API2-MALT1 expression on the normal immune response of transgenic mice.
17101977 CARMA3/Bcl10/MALT1-dependent NF-kappaB activation mediates angiotensin II-responsive inflammatory signaling in hepatocytes.
16891304 the t(11, 18)(q21;q21) translocation creating the c-IAP2.MALT1 fusion protein activates NF-kappaB independently of TRAF1 AND TRAF2 and contributes to human malignancy in the absence of signaling adaptors that might otherwise regulate its activity
16804917 MALT1-MAP4 fusion does not result in activation of NF-kappa B as with other MALT1-associated translocations.
16630178 This study demonstrates that translocations involving MALT1, including IGH/MALT1, are uncommon in cutaneous MALT lymphomas and primary cutaneous DLBCL.
16395405 Chromosomal translocations leads to upregulation of either BCL10 or MALT1 or the generation of a fusion protein, cIAP2-MALT1.
16395399 Common translocation in MALT lymphoma results in a fusion of the cIAP2 region on chromosome 11q21 with the MALT1 gene on chromosome 18q21.
16341151 Study further supports the close interaction between the MALT1 and BCL10 proteins in the pathogenesis of MALT lymphomas.
16123224 nucleocytoplasmic shuttling of MALT1 and BCL10 complex may indicate that these molecules are involved not only in the nuclear factor kappaB (NF-kappaB) pathway but also in other biologic functions in lymphocytes
15982633 Taken together, our results strongly indicated that API2-MALT1 possesses a novel mechanism of self-activation by up-regulating its own expression in t(11;18)(q21;q21)-carrying MALT lymphomas.
15696476 API2-MALT1 transcript was confirmed to be associated with the levels of apoptosis and API2 of MALT lymphoma.
15598810 NF-kappa B signaling, once activated in a CD40-dependent immune response, is maintained and enhanced through deregulation of MALT1 or formation of an API2-MALT1 fusion.
15363040 Detection of API2-MALT1 fusion transcripts is useful for evaluating the prognosis and clinical behavior of the MALT lymphoma.
15191563 Translocation breakpoint never exceeded 2.5% in B-cell lymphoma
14760068 MALT1 chromosome rearrangements have a role in MALT gastric lymphomas in patients with Sjogren's syndrome
14562112 copy numbers of API2-MALT1 do not reflect tumor cell proportions, and that the number of copies of API2-MALT1 in a tumor cell is different for each clinical sample.
12931213 translocations t(11;18)(q21;q21) and t(14;18)(q21;q32) represent the main structural aberrations involving MLT/MALT1 in MALT lymphomas, whereas true amplifications of MLT/MALT1 occur rarely in MZBCL
12651604 Fuses with API2 and defines a distinctive clinicopathologic subtype in pulmonary extranodal marginal zone B-cell lymphoma of mucosa-associated lymphoid tissue.
11960389 REVIEW: Genetic alterations involving MALT1 underlying the pathogenesis of MALT lymphoma

AA Sequence

MSLLGDPLQALPPSAAPTGPLLAPPAGATLNRLREPLLRRLSELLDQAPEGRGWRRLAELAGSRGRLRLS      1 - 70
CLDLEQCSLKVLEPEGSPSLCLLKLMGEKGCTVTELSDFLQAMEHTEVLQLLSPPGIKITVNPESKAVLA     71 - 140
GQFVKLCCRATGHPFVQYQWFKMNKEIPNGNTSELIFNAVHVKDAGFYVCRVNNNFTFEFSQWSQLDVCD    141 - 210
IPESFQRSVDGVSESKLQICVEPTSQKLMPGSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYV    211 - 280
DLEHQGTYWCHVYNDRDSQDSKKVEIIIGRTDEAVECTEDELNNLGHPDNKEQTTDQPLAKDKVALLIGN    281 - 350
MNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENF    351 - 420
GNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGY    421 - 490
ATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRAL    491 - 560
TDPIQGTEYSAESLVRNLQWAKAHELPESMCLKFDCGVQIQLGFAAEFSNVMIIYTSIVYKPPEIIMCDA    561 - 630
YVTDFPLDLDIDPKDANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVE    631 - 700
DKQEVNVGKPLIAKLDMHRGLGRKTCFQTCLMSNGPYQSSAATSGGAGHYHSLQDPFHGVYHSHPGNPSN    701 - 770
VTPADSCHCSRTPDAFISSFAHHASCHFSRSNVPVETTDEIPFSFSDRLRISEK                    771 - 824
//

Text Mined References (126)

PMID Year Title
27070702 2016 Targeting Non-proteolytic Protein Ubiquitination for the Treatment of Diffuse Large B Cell Lymphoma.
27068814 2016 Alternative splicing of MALT1 controls signalling and activation of CD4(+) T cells.
26788853 2016 Backbone Assignment of the MALT1 Paracaspase by Solution NMR.
26787500 2016 Targeting MALT1 Proteolytic Activity in Immunity, Inflammation and Disease: Good or Bad?
26767426 2016 MALT1 Protease Activity Controls the Expression of Inflammatory Genes in Keratinocytes upon Zymosan Stimulation.
26716947 2016 The paracaspase MALT1 dampens NF-?B signalling by cleaving the LUBAC subunit HOIL-1.
26668357 2015 Lymphomagenic CARD11/BCL10/MALT1 signaling drives malignant B-cell proliferation via cooperative NF-?B and JNK activation.
26573773 2016 MALT1 cleaves the E3 ubiquitin ligase HOIL-1 in activated T cells, generating a dominant negative inhibitor of LUBAC-induced NF-?B signaling.
26540570 2015 Combinatorial BTK and MALT1 inhibition augments killing of CD79 mutant diffuse large B cell lymphoma.
26525107 2015 The paracaspase MALT1 cleaves HOIL1 reducing linear ubiquitination by LUBAC to dampen lymphocyte NF-?B signalling.
26507244 2016 The paracaspase MALT1: biological function and potential for therapeutic inhibition.
26386283 2016 The Paracaspase MALT1.
26377317 2016 MALT1 is not alone after all: identification of novel paracaspases.
25996250 2015 MALT1--a universal soldier: multiple strategies to ensure NF-?B activation and target gene expression.
25982276 2016 MALT1 is required for EGFR-induced NF-?B activation and contributes to EGFR-driven lung cancer progression.
25748427 2015 MALT1-ubiquitination triggers non-genomic NF-?B/IKK signaling upon platelet activation.
25569716 2015 Conversion of the LIMA1 tumour suppressor into an oncogenic LMO-like protein by API2-MALT1 in MALT lymphoma.
25502755 2014 An integrated epigenomic analysis for type 2 diabetes susceptibility loci in monozygotic twins.
25500259 2015 MALT1 induced immune response is governed by miR-2909 RNomics.
25384343 2014 Characteristics of CARMA1-BCL10-MALT1-A20-NF-?B expression in T cell-acute lymphocytic leukemia.
25285878 2014 Targeting B-cell lymphomas with inhibitors of the MALT1 paracaspase.
25105596 2014 MALT1 auto-proteolysis is essential for NF-?B-dependent gene transcription in activated lymphocytes.
24971370 2014 Alternative expression pattern of MALT1-A20-NF-?B in patients with rheumatoid arthritis.
24332264 2014 Combined immunodeficiency associated with homozygous MALT1 mutations.
24074955 2013 Structural architecture of the CARMA1/Bcl10/MALT1 signalosome: nucleation-induced filamentous assembly.
24004675 2013 Molecular pathways: targeting MALT1 paracaspase activity in lymphoma.
23977204 2013 Monoubiquitination and activity of the paracaspase MALT1 requires glutamate 549 in the dimerization interface.
23946259 2013 Structural analysis of phenothiazine derivatives as allosteric inhibitors of the MALT1 paracaspase.
23799590 2013 Proteomic identification of keratin alterations with enhanced proliferation of oral carcinoma cells by loss of mucosa-associated lymphoid tissue 1 expression.
23778523 2013 Inhibition of TGF-? and EGF pathway gene expression and migration of oral carcinoma cells by mucosa-associated lymphoid tissue 1.
23770847 2014 The API2-MALT1 fusion exploits TNFR pathway-associated RIP1 ubiquitination to promote oncogenic NF-?B signaling.
23727036 2013 A homozygous mucosa-associated lymphoid tissue 1 (MALT1) mutation in a family with combined immunodeficiency.
23416615 2013 The protease activity of the paracaspase MALT1 is controlled by monoubiquitination.
23358872 2013 The HECTD3 E3 ubiquitin ligase suppresses cisplatin-induced apoptosis via stabilizing MALT1.
23264041 2013 USP2a positively regulates TCR-induced NF-?B activation by bridging MALT1-TRAF6.
23238017 2012 Pharmacologic inhibition of MALT1 protease by phenothiazines as a therapeutic approach for the treatment of aggressive ABC-DLBCL.
23238016 2012 MALT1 small molecule inhibitors specifically suppress ABC-DLBCL in vitro and in vivo.
23018871 2013 T(14;18)(q32;q21) involving MALT1 and IGH genes occurs in extranodal diffuse large B-cell lymphomas of the breast and testis.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22752732 2013 Single nucleotide polymorphisms of mucosa-associated lymphoid tissue 1 in oral carcinoma cells and gingival fibroblasts.
22689981 2012 Expression of MALT1 oncogene in hematopoietic stem/progenitor cells recapitulates the pathogenesis of human lymphoma in mice.
22574776 2012 Protease activity of MALT1: a mystery unravelled.
22528498 2012 Protein kinase C-? negatively regulates T cell receptor-induced NF-?B activation by inhibiting the assembly of CARMA1 signalosome.
22366302 2012 Structural determinants of MALT1 protease activity.
22309193 2012 Mechanism and specificity of the human paracaspase MALT1.
22267217 2012 Dectin-1 is an extracellular pathogen sensor for the induction and processing of IL-1? via a noncanonical caspase-8 inflammasome.
21966355 2011 Oligomeric structure of the MALT1 tandem Ig-like domains.
21873235 2011 Malt1-dependent RelB cleavage promotes canonical NF-kappaB activation in lymphocytes and lymphoma cell lines.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21757570 2012 Detection of MALT1 gene rearrangements in BAL fluid cells for the diagnosis of pulmonary mucosa-associated lymphoid tissue lymphoma.
21448133 2011 T-cell receptor-induced JNK activation requires proteolytic inactivation of CYLD by MALT1.
21283787 2011 Selective C-Rel activation via Malt1 controls anti-fungal T(H)-17 immunity by dectin-1 and dectin-2.
21273489 2011 Cleavage of NIK by the API2-MALT1 fusion oncoprotein leads to noncanonical NF-kappaB activation.
21269460 2011 Initial characterization of the human central proteome.
21157432 2011 Dephosphorylation of Carma1 by PP2A negatively regulates T-cell activation.
21055028 2010 [Study on genetic aberrations of ocular mucosa-associated lymphoid tissue lymphomas occurring in southern China].
20804738 2010 Cleavage by MALT1 induces cytosolic release of A20.
20695076 2009 CXCL12/SDF-1 alpha activates NF-kappaB and promotes oral cancer invasion through the Carma3/Bcl10/Malt1 complex.
20079017 2009 [Prevalence of API2-MALT1 fusion gene in gastrointestinal mucosa-associated lymphoid tissue lymphomas and diffuse large B cell lymphomas].
19965626 2010 The t(14;18)(q32;q21)/IGH-MALT1 translocation in MALT lymphomas contains templated nucleotide insertions and a major breakpoint region similar to follicular and mantle cell lymphoma.
19897720 2009 Essential role of MALT1 protease activity in activated B cell-like diffuse large B-cell lymphoma.
19841089 2009 Inhibition of MALT1 protease activity is selectively toxic for activated B cell-like diffuse large B cell lymphoma cells.
19494296 2009 A20 negatively regulates T cell receptor signaling to NF-kappaB by cleaving Malt1 ubiquitin chains.
19444310 2009 COP9 signalosome controls the Carma1-Bcl10-Malt1 complex upon T-cell stimulation.
19394813 2009 Germline variations of the MALT1 gene as risk factors in the development of primary gastric B-cell lymphoma.
19279678 2009 Auto-ubiquitination-induced degradation of MALT1-API2 prevents BCL10 destabilization in t(11;18)(q21;q21)-positive MALT lymphoma.
19234489 2009 TRAF2-binding BIR1 domain of c-IAP2/MALT1 fusion protein is essential for activation of NF-kappaB.
19112107 2009 CXCL8/IL8 stimulates vascular endothelial growth factor (VEGF) expression and the autocrine activation of VEGFR2 in endothelial cells by activating NFkappaB through the CBM (Carma3/Bcl10/Malt1) complex.
19060847 2009 Methylation and API2/MALT1 fusion in colorectal extranodal marginal zone lymphoma.
18806265 2008 Multiple protein domains mediate interaction between Bcl10 and MALT1.
18691973 2008 The paracaspase MALT1 controls caspase-8 activation during lymphocyte proliferation.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18625728 2008 The protein kinase C-responsive inhibitory domain of CARD11 functions in NF-kappaB activation to regulate the association of multiple signaling cofactors that differentially depend on Bcl10 and MALT1 for association.
18367485 2008 Gain of chromosome region 18q21 including the MALT1 gene is associated with the activated B-cell-like gene expression subtype and increased BCL2 gene dosage and protein expression in diffuse large B-cell lymphoma.
18264101 2008 The proteolytic activity of the paracaspase MALT1 is key in T cell activation.
18231929 2008 Analysis of CARMA1/BCL10/MALT1 expression in Reed-Sternberg cells of classical Hodgkin lymphoma.
18223652 2008 T cell antigen receptor stimulation induces MALT1 paracaspase-mediated cleavage of the NF-kappaB inhibitor A20.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17948050 2007 Malt1 ubiquitination triggers NF-kappaB signaling upon T-cell activation.
17894851 2008 Clinical features and prognosis of gastric MALT lymphoma with special reference to responsiveness to H. pylori eradication and API2-MALT1 status.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17199743 2007 MALT1, BCL10 and FOXP1 in salivary gland mucosa-associated lymphoid tissue lymphomas.
17145608 2006 Splenic marginal zone lymphoma-like features in API2-MALT1 transgenic mice that are exposed to antigenic stimulation.
17135271 2007 Site-specific Lys-63-linked tumor necrosis factor receptor-associated factor 6 auto-ubiquitination is a critical determinant of I kappa B kinase activation.
17101977 2007 CARMA3/Bcl10/MALT1-dependent NF-kappaB activation mediates angiotensin II-responsive inflammatory signaling in nonimmune cells.
17047224 2006 Regulation and function of IKK and IKK-related kinases.
16891304 2006 The inhibitor of apoptosis protein fusion c-IAP2.MALT1 stimulates NF-kappaB activation independently of TRAF1 AND TRAF2.
16874300 2006 The signaling adapter p62 is an important mediator of T helper 2 cell function and allergic airway inflammation.
16804917 2006 A novel fusion of the MALT1 gene and the microtubule-associated protein 4 (MAP4) gene occurs in diffuse large B-cell lymphoma.
16630178 2006 t(14;18)(q32;q21) involving IGH and MALT1 is uncommon in cutaneous MALT lymphomas and primary cutaneous diffuse large B-cell lymphomas.
16395405 2006 cIAP2 is a ubiquitin protein ligase for BCL10 and is dysregulated in mucosa-associated lymphoid tissue lymphomas.
16395399 2006 Delving deeper into MALT lymphoma biology.
16341151 2006 MALT1 and BCL10 aberrations in MALT lymphomas and their effect on the expression of BCL10 in the tumour cells.
16123224 2005 MALT1 contains nuclear export signals and regulates cytoplasmic localization of BCL10.
15982633 2005 API2-MALT1 fusion protein induces transcriptional activation of the API2 gene through NF-kappaB binding elements: evidence for a positive feed-back loop pathway resulting in unremitting NF-kappaB activation.
15696476 2005 [The frequency of API2-MALT1 fusion gene variants in MALT lymphoma and its correlation with apoptosis of MALT lymphoma].
15598810 2005 MALT1 and the API2-MALT1 fusion act between CD40 and IKK and confer NF-kappa B-dependent proliferative advantage and resistance against FAS-induced cell death in B cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15363040 2004 Extranodal marginal zone B-cell lymphoma of mucosa-associated lymphoid tissue (MALT lymphoma) arising in the small intestine with monoclonal cryoglobulinemia.
15191563 2004 Molecular cytogenetic analysis of chromosomal breakpoints in the IGH, MYC, BCL6, and MALT1 gene loci in primary cutaneous B-cell lymphomas.
15125833 2004 The TRAF6 ubiquitin ligase and TAK1 kinase mediate IKK activation by BCL10 and MALT1 in T lymphocytes.
14760068 2004 Frequency of chromosomal aberrations involving MALT1 in mucosa-associated lymphoid tissue lymphoma in patients with Sjögren's syndrome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14695475 2004 Bcl10 activates the NF-kappaB pathway through ubiquitination of NEMO.
14562112 2003 Heterogeneous copy numbers of API2-MALT1 chimeric transcripts in mucosa-associated lymphoid tissue lymphoma.
12931213 2003 Translocations t(11;18)(q21;q21) and t(14;18)(q32;q21) are the main chromosomal abnormalities involving MLT/MALT1 in MALT lymphomas.
12819136 2003 Comparative analysis of apoptosis and inflammation genes of mice and humans.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12651604 2003 API2-MALT1 fusion defines a distinctive clinicopathologic subtype in pulmonary extranodal marginal zone B-cell lymphoma of mucosa-associated lymphoid tissue.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12406890 2003 T(14;18)(q32;q21) involving IGH and MALT1 is a frequent chromosomal aberration in MALT lymphoma.
11960389 2002 Genetic alterations underlying the pathogenesis of MALT lymphoma.
11707622 2001 Marginal-zone B-cell lymphoma of extranodal mucosa-associated lymphoid tissue type: molecular genetics provides new insights into pathogenesis.
11262391 2001 Bcl10 and MALT1, independent targets of chromosomal translocation in malt lymphoma, cooperate in a novel NF-kappa B signaling pathway.
11162514 2001 Molecular characterization of the genomic breakpoint junction in the t(11;18) (q21;q21) translocation of a gastric MALT lymphoma.
11096264 2001 The API2/MALT1 fusion product may lead to germinal center B cell lymphomas by suppression of apoptosis.
11090634 2000 Identification of paracaspases and metacaspases: two ancient families of caspase-like proteins, one of which plays a key role in MALT lymphoma.
10702396 2000 API2-MALT1 chimeric transcripts involved in mucosa-associated lymphoid tissue type lymphoma predict heterogeneous products.
10626814 1999 Breakpoints of the t(11;18)(q21;q21) in mucosa-associated lymphoid tissue (MALT) lymphoma lie within or near the previously undescribed gene MALT1 in chromosome 18.
10610122 1999 API1-MALT1-MLT is involved in mucosa-associated lymphoid tissue lymphoma with t(11;18)(q21;q21)
10523859 1999 A novel gene, MALT1 at 18q21, is involved in t(11;18) (q21;q21) found in low-grade B-cell lymphoma of mucosa-associated lymphoid tissue.
10406266 1999 Mucosa-associated lymphoid tissue (MALT) lymphoma of the rectum with chromosomal translocation of the t(11;18)(q21;q21) and an additional aberration of trisomy 3.
10339464 1999 The apoptosis inhibitor gene API2 and a novel 18q gene, MLT, are recurrently rearranged in the t(11;18)(q21;q21) associated with mucosa-associated lymphoid tissue lymphomas.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.