Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.00
PubTator Score 6.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer -1.300 5.1e-05
pancreatic ductal adenocarcinoma liver m... -1.239 2.2e-02

Gene RIF (3)

AA Sequence

MGPGGRVARLLAPLMWRRAVSSVAGSAVGAEPGLRLLAVQRLPVGAAFCRACQTPNFVRGLHSEPGLEER      1 - 70
AEGTVNEGRPESDAADHTGPKFDIDMMVSLLRQENARDICVIQVPPEMRYTDYFVIVSGTSTRHLHAMAF     71 - 140
YVVKMYKHLKCKRDPHVKIEGKDTDDWLCVDFGSMVIHLMLPETREIYELEKLWTLRSYDDQLAQIAPET    141 - 210
VPEDFILGIEDDTSSVTPVELKCE                                                  211 - 234
//

Text Mined References (15)

PMID Year Title