Property Summary

NCBI Gene PubMed Count 14
PubMed Score 115.21
PubTator Score 41.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
urothelial carcinoma -2.000 5.0e-02
primary pancreatic ductal adenocarcinoma 2.468 2.2e-02
intraductal papillary-mucinous neoplasm ... 2.300 7.5e-04
colon cancer -1.900 8.0e-05
lung cancer -4.900 1.7e-07
pancreatic cancer 2.200 4.9e-02
group 3 medulloblastoma -1.100 8.0e-03
nasopharyngeal carcinoma -1.300 3.4e-04
lung carcinoma -2.800 8.4e-35
spina bifida -2.211 2.6e-02
Breast cancer -1.200 1.3e-03
ovarian cancer 1.300 1.3e-04

Synonym

Accession Q13021 B3KWR6 Q9BTU0
Symbols BENE

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Process (1)

Gene RIF (3)

PMID Text
25496667 Genome-wide shRNA screening identifies MALL, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
25401970 We report the unexpectedly common retinal involvement of NPHP type 1 with an additional MALL deletion in a Korean cohort.
18305945 in colonic serrated adenomas three genes (TNFRSF10A, BENE, RARA) with strongly significant expression intensities in the oligonucleotide microarray

AA Sequence

MASPDPPATSYAPSDVPSGVALFLTIPFAFFLPELIFGFLVWTMVAATHIVYPLLQGWVMYVSLTSFLIS      1 - 70
LMFLLSYLFGFYKRFESWRVLDSLYHGTTGILYMSAAVLQVHATIVSEKLLDPRIYYINSAASFFAFIAT     71 - 140
LLYILHAFSIYYH                                                             141 - 153
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25401970 2015 Atypical retinopathy in patients with nephronophthisis type 1: an uncommon ophthalmological finding.
18305945 2008 Gene profiling of colonic serrated adenomas by using oligonucleotide microarray.
16341674 2005 Transcriptome analysis of human gastric cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11294831 2001 BENE, a novel raft-associated protein of the MAL proteolipid family, interacts with caveolin-1 in human endothelial-like ECV304 cells.
9361039 1997 A novel gene that encodes a protein with a putative src homology 3 domain is a candidate gene for familial juvenile nephronophthisis.
9326933 1997 A novel gene encoding an SH3 domain protein is mutated in nephronophthisis type 1.
9168137 1997 Myelin and lymphocyte protein (MAL/MVP17/VIP17) and plasmolipin are members of an extended gene family.
7622049 1995 Searching for non-V kappa transcripts from the human immunoglobulin kappa locus.
1294831 [An evaluation of the efficacy of dispensary care as a method for the active detection of skin melanoma].