Property Summary

NCBI Gene PubMed Count 101
PubMed Score 0.00
PubTator Score 30.13

Knowledge Summary

Patent

No data available

Gene RIF (78)

PMID Text
26926567 miR-1 bound both MALAT1 and cdc42 3'UTR directly. Further study showed that MALAT1 induced migration and invasion of breast cancer cells while reduced the level of cdc42.
26854446 robust correlation could be obtained between MALAT-1 overexpression with lymph node metastasis, tumor differentiation and clinical stage
26826711 Natural antisense RNA promotes 3' end processing and maturation of MALAT1 lncRNA.
26821178 The overexpression of MALAT-1 may be a potential prognostic indicator for various human cancers.
26782531 An elevated MALAT1 expression correlates with large tumor size, advanced tumor stage, and poor prognosis, and might therefore be utilized to evaluate clinical pathological features and prognostic outcome for cancer patients. (Meta-analysis)
26722461 MALAT-1 may play an important role in the regulation of proliferation, cell cycle, apoptosis, migration and invasion of trophoblast cells, and under-expression of MALAT-1 during early placentation may be involved in the pathogenesis of preeclampsia.
26634309 Using drugs that specifically inhibit or activate the PERK or IRE1alpha sensors, we demonstrate that signalling through the PERK axis activates this expression, through a transcriptional mechanism
26619802 there was reciprocal repression between MALAT1 and miR-140, and miR-140 mediated the effects that MALAT1 knockdown exerted
26614531 MALAT1 level is associated with liver damage, and has clinical utility for predicting development of hepatocellular carcinoma
26522444 MALAT1 is an important prognostic factor and therapeutic target for OSCC.
26516927 Data show that long non-coding RNA MALAT1 may be a crucial RNA cofactor of Polycomb protein enhancer of zeste homolog 2 (EZH2) and that may provide a new avenue for development new strategies for treatment of castration-resistant prostate cancer (CRPC).
26461224 High MALAT1 expression is associated with clear cell kidney carcinoma.
26434412 In this review, we document the molecular characteristics and functions of MALAT1 and shed light on the implication in the molecular pathology of various cancers.
26423854 MALAT1 may potentially be used as a new prognostic marker to predict poorer survival of patients with cancer.
26415832 Posttranscriptional silencing of MALAT1 by miR-217 provides a link, through EZH2, between ncRNAs and the EMT and establishes a mechanism for cigarette smoke extract-induced lung carcinogenesis.
26406400 High MALAT1 expression was associated with esophageal squamous cell carcinoma.
26364720 Data show that long ncRNAs MALAT1 silencing downregulated the expression of the microRNA miR-22-3p target gene CXCR2 and AKT pathway.
26352013 Human SP1 and SP3 transcription factors regulate MALAT1 expression in hepatocellular carcinoma.
26335021 Malat1 plays a critical role in maintaining the proliferation potential of early-stage hematopoietic cells.
26275461 Hsa-miR-1 suppresses breast cancer development by down-regulating K-ras and long non-coding RNA MALAT1
26265046 MALAT1 expression by regulation of TDP-43 controls cellular growth, migration, and invasion of non-small cell lung cancer cells in vitro.
26241674 MALAT1 is a potential prognostic indicator and a target for the diagnosis and gene therapy for PVR diseases.
26191181 MALAT1 is a novel regulator of epithelial-mesenchymal transformation in breast cancer.
26159858 A poorer OS in patients with high MALAT-1 expression.
26139386 Study indicates that NEAT1 and MALAT1 may interact with HIV-1 in vivo. The correlation between plasma levels of NEAT1 and CD4 T-cell counts indicates that NEAT1 levels in plasma could be a potential biomarker for HIV-1 infection.
25811929 Results found the potential effects of MALAT-1 on the stem cell-like phenotypes in pancreatic cancer cells, suggesting a novel role of MALAT-1 in tumor stemness.
25787249 Studies indicate that long non-coding RNA MALAT1 regulates glucose-induced up-regulation of inflammatory mediators tumour necrosis factor alpha (TNF-alpha) and interleukin 6 (IL-6) through activation of serum amyloid antigen 3 (SAA3).
25773124 The data suggest that upregulation of MALAT1 was mediated by the transcription factor Sp1 in A549 lung cancer cells
25772239 Loss of WIF1 enhances the migratory potential of glioblastoma through WNT5A that activates the WNT/Ca(2+) pathway and MALAT1.
25613496 MALAT1 serves as an oncogene in ESCC, and it regulates ESCC growth by modifying the ATM-CHK2 pathway.
25613066 lncRNA MALAT1 plays an important role on glioma progression and prognosis.
25600645 MALAT1 expression was higher in human renal cell carcinoma tissues, where it was associated with reduced patient survival.
25546229 tumor-associated dendritic cell-derived CCL5 increases human colon cancer cell migration, invasion and epithelial-to-mesenchymal transition in a MALAT-1dependent manner
25538231 High MALAT1 expression is associated with proliferation, migration, and invasion of esophageal squamous cell carcinoma.
25481511 overexpression of lncRNA MALAT1 serves as an unfavorable prognostic biomarker in pancreatic cancer patients.
25480417 Our data suggested that lncRNA MALAT1 was a novel molecule involved in ccRCC progression, which provided a potential prognostic biomarker and therapeutic target.
25446987 data indicate that MALAT1 may promote CRC tumor development via its target protein AKAP-9
25431257 MALAT1 might suppress the tumor growth and metastasis via PI3K/AKT signaling pathway.
25369863 MALAT1 was overexpressed in patients with myeloma and may play a role in its pathogenesis. In addition, MALAT1 may serve as a molecular predictor of early progression.
25280565 High MALAT1 expression drives gastric cancer development and promotes peritoneal metastasis.
25269958 MALAT-1 may serve as an oncogenic lncRNA that is involved in malignancy phenotypes of pancreatic cancer.
25217850 Results showed that the high level of MALAT1 is associated with lung cancer brain metastasis and survival and demonstrated the potential role of MALAT1 in identification of non-small cell lung cancer patients at high risk of brain metastasis
25187517 the mechanism of transcriptional activation of LTBP3 promoter depends on MALAT1 initiated from neighboring gene LTBP3 and involves both the direct interaction of the Sp1 and promoter-specific activation
25085246 Findings establish a novel PCDH10-Wnt/beta-catenin-MALAT1 regulatory axis that contributes to EEC development.
25036876 An interaction of Bcl-2 with MALAT-1 lncRNA expression was revealed, which merits further investigation for risk prediction in resectable NSCLC patients.
25031737 The expression of MALAT1 is upregulated in colorectal cancer
25025966 MALAT1 binds to SFPQ releasing PTBP2 from the SFPQ/PTBP2 complex, the increased SFPQ-detached PTBP2 promotes cell proliferation and migration in colorectal cancer.
24892958 Knockdown of UCA1 or Malat-1 lncRNA could attenuate the migrational ability of melanoma cells in in-vitro studies. Increased expression of UCA1 and Malat-1 lncRNAs might have a correlation with melanoma metastasis.
24857172 These results suggest that MALAT1 may function as a promoter of gastric cancer cell proliferation partly by regulating SF2/ASF.
24815433 MALAT1 might be considered as a potential prognostic indicator and may be a target for diagnosis and gene therapy for pancreatic duct adenocarcinoma.
24658096 MALAT1 might serve as an oncogenic lncRNA that promotes proliferation and metastasis of gallbladder cancer and activates the ERK/MAPK pathway.
24602777 MALAT1 regulates endothelial cell proliferation/migration and vessel growth.
24468535 Malat1 is a critical regulator of maintaining the transformative phenotype in liver cancer.
24449823 malat1 promotes bladder cancer metastasis by associating with suz12.
24244343 resveratrol down-regulates MALAT1, resulting in decreased nuclear localization of beta-catenin thus attenuated Wnt/beta-catenin signaling, which leads to the inhibition of CRC invasion and metastasis.
24120702 Genetic translocations involving MALAT1 gene is associated with mesenchymal hamartoma of the liver.
23973260 down-regulation of MALAT-1 expression compromised the cytoplasmic translocation of hnRNP C in the G2/M phase and resulted in G2/M arrest
23898077 The levels of plasma lncRNAs, H19, HOX antisense intergenic RNA (HOTAIR), and metastasis associated lung adenocarcinoma transcript-1 (MALAT1), were analyzed in patients with gastric cancer (GC) and healthy controls.
23726266 MALAT-1 miniRNA can be used as a novel plasma-based biomarker for prostate cancer detection and can improve diagnostic accuracy by predicting prostate biopsy outcomes.
23555285 These findings provide mechanistic insights on the role of MALAT1 in regulating cellular proliferation
23243023 The noncoding RNA MALAT1 is a critical regulator of the metastasis phenotype of lung cancer cells.
23153939 MALAT1 is upregulated in urothelial carcinoma of the bladder, and high MALAT1 expression levels were associated with high-grade and high-stage carcinoma.
23129630 Formation of triple-helical structures by the 3'-end sequences of MALAT1 and MENbeta noncoding RNAs, is reported.
22858678 The quantitative loss of MALAT1 did neither affect proliferation nor cell cycle progression nor nuclear architecture in human lung or liver cancer cells.
22722759 Study verified that MALAT-1 levels were upregulated in bladder cancer tissues compared with adjacent normal tissues, and MALAT-1 expression was remarkably increased in primary tumors that subsequently metastasized
22560368 MALAT-1 is upregulated in specific regions of the human alcoholic brain.
22088988 Our results suggest that MALAT-1 transcript induces migration in Non-small cell lung cancers and stimulates tumor growth and invasion in vivo.
22078878 Pc2, methylation controls the protein's interaction with two distinct ncRNAs, TUG1 and NEAT2, which results in the exclusive subnuclear localization of methylated and unmethylated Pc2 in Polycomb bodies and interchromatin granules, respectively.
21941126 Studies indicate the correlation of differential expression of metastasis-associated lung adenocarcinoma transcript1 (MALAT1) with tumor development, progression or survival in several cancerous conditions.
21678027 Our data suggest that MALAT1 plays an important role in tumor progression and could be a novel biomarker for predicting tumor recurrence after liver transplantation
21503572 mutations were found on the long non-coding RNA MALAT-1 in CRC colorectal cancer
20797886 MALAT1 regulates alternative splicing by modulating the levels of active serine/arginine (SR) splicing factors.
20711585 The expression of the long ncRNA MALAT1 correlates with tumor development, progression or survival in lung, liver and breast cancer.
20213048 Our data demonstrated that MALAT1 was involved in cervical cancer cell growth, cell cycle progression, and invasion through the regulation of gene expression.
20149803 expression of the tumor marker MALAT1 noncoding RNA is sensitive to cell surface receptor activation by oxytocin in a neuroblastoma cell line
19690017 Results suggest that MALAT-1 in placenta previa I/P is increased and its down-regulation inhibits trophoblast-like cell invasion. MALAT-1 might be involved in regulating trophoblast invasion during the development of advanced invasive placentation.
19041754 Study identified a highly conserved small RNA of 61 nucleotides originating from the MALAT1 locus that is broadly expressed in human tissues; although the long MALAT1 transcript localizes to nuclear speckles, the small RNA is found only in the cytoplasm.
16441420 Upregulation of MALAT-1 is associated with endometrial stromal sarcoma of the uterus

AA Sequence

MQIMFSSVVRISGLCLFPNGGMTYNLFCLYLSIHQGAVFSASRPSYCQAGYDSEDVI                   1 - 57
//

Text Mined References (101)

PMID Year Title
27872311 2016 Methyltransferase-like protein 16 binds the 3'-terminal triple helix of MALAT1 long noncoding RNA.
27862640 2017 Long non-coding RNA MALAT1 functions as a mediator in cardioprotective effects of fentanyl in myocardial ischemia-reperfusion injury.
27841943 2016 MALAT1 in human adipose stem cells modulates survival and alternative splicing of PKC?II in HT22 cells.
27814602 2017 MALAT1-mediated tumorigenesis.
27782152 2016 HULC cooperates with MALAT1 to aggravate liver cancer stem cells growth through telomere repeat-binding factor 2.
27693631 2016 Disrupting MALAT1/miR-200c sponge decreases invasion and migration in endometrioid endometrial carcinoma.
27374227 2016 Long non-coding RNA Malat1 promotes neurite outgrowth through activation of ERK/MAPK signalling pathway in N2a cells.
27250026 2016 Functional and prognostic significance of long non-coding RNA MALAT1 as a metastasis driver in ER negative lymph node negative breast cancer.
26926567 2016 MALAT1 induced migration and invasion of human breast cancer cells by competitively binding miR-1 with cdc42.
26854446 Human MALAT-1 long non-coding RNA is overexpressed in cervical cancer metastasis and promotes cell proliferation, invasion and migration.
26826711 2016 Natural antisense RNA promotes 3' end processing and maturation of MALAT1 lncRNA.
26821178 2016 Long Noncoding RNA MALAT-1 Can Predict Poor Prognosis: A Meta-Analysis.
26782531 2015 Correlation of increased MALAT1 expression with pathological features and prognosis in cancer patients: a meta-analysis.
26722461 2015 Long non-coding RNA MALAT-1 is downregulated in preeclampsia and regulates proliferation, apoptosis, migration and invasion of JEG-3 trophoblast cells.
26634309 2015 The Malat1 long non-coding RNA is upregulated by signalling through the PERK axis of unfolded protein response during flavivirus infection.
26619802 2016 Knockdown of long non-coding RNA MALAT1 increases the blood-tumor barrier permeability by up-regulating miR-140.
26614531 2016 Plasma level of metastasis-associated lung adenocarcinoma transcript 1 is associated with liver damage and predicts development of hepatocellular carcinoma.
26522444 2015 Long Non Coding RNA MALAT1 Promotes Tumor Growth and Metastasis by inducing Epithelial-Mesenchymal Transition in Oral Squamous Cell Carcinoma.
26516927 2015 LncRNA MALAT1 enhances oncogenic activities of EZH2 in castration-resistant prostate cancer.
26461224 2015 LncRNA MALAT1 functions as a competing endogenous RNA to regulate ZEB2 expression by sponging miR-200s in clear cell kidney carcinoma.
26434412 2016 MALAT1 long non-coding RNA in cancer.
26423854 2015 Clinical value of lncRNA MALAT1 as a prognostic marker in human cancer: systematic review and meta-analysis.
26415832 2015 Posttranscriptional silencing of the lncRNA MALAT1 by miR-217 inhibits the epithelial-mesenchymal transition via enhancer of zeste homolog 2 in the malignant transformation of HBE cells induced by cigarette smoke extract.
26406400 2015 MALAT1 might be a predictive marker of poor prognosis in patients who underwent radical resection of middle thoracic esophageal squamous cell carcinoma.
26364720 2015 The lncRNA MALAT1 protects the endothelium against ox-LDL-induced dysfunction via upregulating the expression of the miR-22-3p target genes CXCR2 and AKT.
26352013 2015 Sp1 cooperates with Sp3 to upregulate MALAT1 expression in human hepatocellular carcinoma.
26335021 2015 Malat1 as an evolutionarily conserved lncRNA, plays a positive role in regulating proliferation and maintaining undifferentiated status of early-stage hematopoietic cells.
26311052 2016 Long non-coding RNA MALAT1 modulates radiosensitivity of HR-HPV+ cervical cancer via sponging miR-145.
26282005 2016 Prognostic value of long noncoding RNA MALAT1 in various carcinomas: evidence from nine studies.
26275461 2015 Hsa-miR-1 suppresses breast cancer development by down-regulating K-ras and long non-coding RNA MALAT1.
26265046 2015 Regulation of MALAT1 expression by TDP43 controls the migration and invasion of non-small cell lung cancer cells in vitro.
26241674 2015 Identification and characterization of proliferative retinopathy-related long noncoding RNAs.
26191181 2015 Downregulation of long noncoding RNA MALAT1 induces epithelial-to-mesenchymal transition via the PI3K-AKT pathway in breast cancer.
26159858 2015 Long Noncoding RNA MALAT-1 Can Predict Metastasis and a Poor Prognosis: a Meta-Analysis.
26139386 2016 Detection of the long noncoding RNAs nuclear-enriched autosomal transcript 1 (NEAT1) and metastasis associated lung adenocarcinoma transcript 1 in the peripheral blood of HIV-1-infected patients.
25811929 2015 Long noncoding RNA MALAT-1 enhances stem cell-like phenotypes in pancreatic cancer cells.
25787249 2015 Long non-coding RNA MALAT1 regulates hyperglycaemia induced inflammatory process in the endothelial cells.
25773124 2015 Sp1-mediated transcriptional regulation of MALAT1 plays a critical role in tumor.
25772239 2016 WIF1 re-expression in glioblastoma inhibits migration through attenuation of non-canonical WNT signaling by downregulating the lncRNA MALAT1.
25613496 2015 Up-regulation of long noncoding RNA MALAT1 contributes to proliferation and metastasis in esophageal squamous cell carcinoma.
25613066 2015 Long noncoding RNA MALAT1 associates with the malignant status and poor prognosis in glioma.
25600645 2015 Long Noncoding RNA MALAT1 Promotes Aggressive Renal Cell Carcinoma through Ezh2 and Interacts with miR-205.
25546229 2015 Chemokine (C-C Motif) Ligand 5 is Involved in Tumor-Associated Dendritic Cell-Mediated Colon Cancer Progression Through Non-Coding RNA MALAT-1.
25538231 2015 Silencing of long noncoding RNA MALAT1 by miR-101 and miR-217 inhibits proliferation, migration, and invasion of esophageal squamous cell carcinoma cells.
25481511 2015 Overexpression of long non-coding RNA MALAT1 is correlated with clinical progression and unfavorable prognosis in pancreatic cancer.
25480417 2015 Upregulation of long non-coding RNA MALAT1 correlates with tumor progression and poor prognosis in clear cell renal cell carcinoma.
25446987 2015 MALAT1 promotes colorectal cancer cell proliferation/migration/invasion via PRKA kinase anchor protein 9.
25431257 2015 MALAT1 promotes the proliferation and metastasis of osteosarcoma cells by activating the PI3K/Akt pathway.
25369863 2014 MALAT1 long non-coding RNA is overexpressed in multiple myeloma and may serve as a marker to predict disease progression.
25280565 2014 Metastasis-associated long non-coding RNA drives gastric cancer development and promotes peritoneal metastasis.
25269958 2014 Elevated expression level of long noncoding RNA MALAT-1 facilitates cell growth, migration and invasion in pancreatic cancer.
25217850 2015 Long noncoding RNA MALAT1 promotes brain metastasis by inducing epithelial-mesenchymal transition in lung cancer.
25187517 2014 Activation of LTBP3 gene by a long noncoding RNA (lncRNA) MALAT1 transcript in mesenchymal stem cells from multiple myeloma.
25085246 2014 A novel wnt regulatory axis in endometrioid endometrial cancer.
25036876 2014 Prognostic impact of Bcl-2 depends on tumor histology and expression of MALAT-1 lncRNA in non-small-cell lung cancer.
25031737 2014 High expression of lncRNA MALAT1 suggests a biomarker of poor prognosis in colorectal cancer.
25025966 2014 Long non-coding RNA MALAT1 promotes tumour growth and metastasis in colorectal cancer through binding to SFPQ and releasing oncogene PTBP2 from SFPQ/PTBP2 complex.
24952594 2014 Structural insights into the stabilization of MALAT1 noncoding RNA by a bipartite triple helix.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24892958 2014 Potential roles of abnormally expressed long noncoding RNA UCA1 and Malat-1 in metastasis of melanoma.
24857172 2014 MALAT1 promotes cell proliferation in gastric cancer by recruiting SF2/ASF.
24815433 2014 Expression and prognostic significance of lncRNA MALAT1 in pancreatic cancer tissues.
24658096 2014 MALAT1 promotes the proliferation and metastasis of gallbladder cancer cells by activating the ERK/MAPK pathway.
24602777 2014 Long noncoding RNA MALAT1 regulates endothelial cell function and vessel growth.
24468535 2014 Mutual inhibition between YAP and SRSF1 maintains long non-coding RNA, Malat1-induced tumourigenesis in liver cancer.
24449823 2014 TGF-?-induced upregulation of malat1 promotes bladder cancer metastasis by associating with suz12.
24244343 2013 Resveratrol inhibits invasion and metastasis of colorectal cancer cells via MALAT1 mediated Wnt/?-catenin signal pathway.
24120702 2013 Characterization of translocations in mesenchymal hamartoma and undifferentiated embryonal sarcoma of the liver.
24115594 The emerging role of triple helices in RNA biology.
23973260 2013 MALAT-1 interacts with hnRNP C in cell cycle regulation.
23898077 2013 Circulating long non-coding RNAs in plasma of patients with gastric cancer.
23847102 2013 Widespread purifying selection on RNA structure in mammals.
23726266 2013 Long non-coding RNA metastasis associated in lung adenocarcinoma transcript 1 derived miniRNA as a novel plasma-based biomarker for diagnosing prostate cancer.
23555285 2013 Long noncoding RNA MALAT1 controls cell cycle progression by regulating the expression of oncogenic transcription factor B-MYB.
23243023 2013 The noncoding RNA MALAT1 is a critical regulator of the metastasis phenotype of lung cancer cells.
23153939 2013 Inducing cell proliferation inhibition, apoptosis, and motility reduction by silencing long noncoding ribonucleic acid metastasis-associated lung adenocarcinoma transcript 1 in urothelial carcinoma of the bladder.
23129630 2012 Formation of triple-helical structures by the 3'-end sequences of MALAT1 and MEN? noncoding RNAs.
23073843 2012 A triple helix stabilizes the 3' ends of long noncoding RNAs that lack poly(A) tails.
22858678 2012 Loss of the abundant nuclear non-coding RNA MALAT1 is compatible with life and development.
22722759 2012 Upregulated MALAT-1 contributes to bladder cancer cell migration by inducing epithelial-to-mesenchymal transition.
22560368 2012 MALAT-1, a non protein-coding RNA is upregulated in the cerebellum, hippocampus and brain stem of human alcoholics.
22088988 2011 The long noncoding MALAT-1 RNA indicates a poor prognosis in non-small cell lung cancer and induces migration and tumor growth.
22078878 2011 ncRNA- and Pc2 methylation-dependent gene relocation between nuclear structures mediates gene activation programs.
21941126 RNA splicing control: yet another gene regulatory role for long nuclear noncoding RNAs.
21678027 2012 Long non-coding RNA MALAT-1 overexpression predicts tumor recurrence of hepatocellular carcinoma after liver transplantation.
21503572 2011 MALAT-1: a long non-coding RNA and its important 3' end functional motif in colorectal cancer metastasis.
21112873 2011 lncRNAdb: a reference database for long noncoding RNAs.
20797886 2010 The nuclear-retained noncoding RNA MALAT1 regulates alternative splicing by modulating SR splicing factor phosphorylation.
20711585 2010 [Non-coding RNA in malignant tumors. A new world of tumor biomarkers and target structures in cancer cells].
20213048 2010 Inhibition of metastasis-associated lung adenocarcinoma transcript 1 in CaSki human cervical cancer cells suppresses cell proliferation and invasion.
20149803 2010 Oxytocin stimulates expression of a noncoding RNA tumor marker in a human neuroblastoma cell line.
19690017 2009 Metastasis associated lung adenocarcinoma transcript 1 is up-regulated in placenta previa increta/percreta and strongly associated with trophoblast-like cell invasion in vitro.
19041754 2008 3' end processing of a long nuclear-retained noncoding RNA yields a tRNA-like cytoplasmic RNA.
17270048 2007 A screen for nuclear transcripts identifies two linked noncoding RNAs associated with SC35 splicing domains.
16441420 2006 Phenotypic characterization of endometrial stromal sarcoma of the uterus.
12970751 2003 MALAT-1, a novel noncoding RNA, and thymosin beta4 predict metastasis and survival in early-stage non-small cell lung cancer.
12837690 2003 Upregulation of the transcription factor TFEB in t(6;11)(p21;q13)-positive renal cell carcinomas due to promoter substitution.
12719541 2003 Cloning of an Alpha-TFEB fusion in renal tumors harboring the t(6;11)(p21;q13) chromosome translocation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10843802 2000 Construction of a 350-kb sequence-ready 11q13 cosmid contig encompassing the markers D11S4933 and D11S546: mapping of 11 genes and 3 tumor-associated translocation breakpoints.
9253601 1997 A transcript map for the 2.8-Mb region containing the multiple endocrine neoplasia type 1 locus.