Property Summary

NCBI Gene PubMed Count 22
PubMed Score 16.81
PubTator Score 14.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Rheumatoid Arthritis 1170 0.0 1.0

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.345 3.8e-06
medulloblastoma, large-cell -1.200 4.3e-04
non-small cell lung cancer -1.583 1.8e-16
lung adenocarcinoma -1.100 4.3e-11
nasopharyngeal carcinoma -1.200 8.5e-06
lung carcinoma -1.600 4.6e-22
ovarian cancer 1.100 4.4e-10

Gene RIF (8)

PMID Text
26452219 Results identify MAGI3 as a novel tumor suppressor and provide insight into the pathogenesis of glioma.
26248734 Expression levels of MAGI3 and PTEN were significantly downregulated in gliomas.
21134377 MAGI-3 competes with NHERF-2 to negatively regulate LPA2 receptor signaling in colon cancer cells.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18518978 All of the E6 genes from different HPV types displayed similar abilities to mediate the degradation of both p53 and MAGI-3
16904289 These results demonstrate that MAGI-3 interacts directly with LPA(2) and regulates the ability of LPA(2) to activate Erk and RhoA.
12615970 In epithelial cells, MAGI-3 was localized with ZO-1 and cingulin at tight junctions, whereas in primary cultured astrocytes it was found in E-cadherin-based cell-cell contacts and in focal adhesion sites.
12140759 Oncogenic human papillomavirus E6 proteins target the MAGI-2 and MAGI-3 proteins for degradation [MAGI-2, MAGI-3]

AA Sequence

MSKTLKKKKHWLSKVQECAVSWAGPPGDFGAEIRGGAERGEFPYLGRLREEPGGGTCCVVSGKAPSPGDV      1 - 70
LLEVNGTPVSGLTNRDTLAVIRHFREPIRLKTVKPGKVINKDLRHYLSLQFQKGSIDHKLQQVIRDNLYL     71 - 140
RTIPCTTRAPRDGEVPGVDYNFISVEQFKALEESGALLESGTYDGNFYGTPKPPAEPSPFQPDPVDQVLF    141 - 210
DNEFDAESQRKRTTSVSKMERMDSSLPEEEEDEDKEAINGSGNAENRERHSESSDWMKTVPSYNQTNSSM    211 - 280
DFRNYMMRDETLEPLPKNWEMAYTDTGMIYFIDHNTKTTTWLDPRLCKKAKAPEDCEDGELPYGWEKIED    281 - 350
PQYGTYYVDFTLVAQAGVQWHDLGSLQPPPPGFNHLNQKTQFENPVEEAKRKKQLGQVEIGSSKPDMEKS    351 - 420
HFTRDPSQLKGVLVRASLKKSTMGFGFTIIGGDRPDEFLQVKNVLKDGPAAQDGKIAPGDVIVDINGNCV    421 - 490
LGHTHADVVQMFQLVPVNQYVNLTLCRGYPLPDDSEDPVVDIVAATPVINGQSLTKGETCMNPQDFKPGA    491 - 560
MVLEQNGKSGHTLTGDGLNGPSDASEQRVSMASSGSSQPELVTIPLIKGPKGFGFAIADSPTGQKVKMIL    561 - 630
DSQWCQGLQKGDIIKEIYHQNVQNLTHLQVVEVLKQFPVGADVPLLILRGGPPSPTKTAKMKTDKKENAG    631 - 700
SLEAINEPIPQPMPFPPSIIRSGSPKLDPSEVYLKSKTLYEDKPPNTKDLDVFLRKQESGFGFRVLGGDG    701 - 770
PDQSIYIGAIIPLGAAEKDGRLRAADELMCIDGIPVKGKSHKQVLDLMTTAARNGHVLLTVRRKIFYGEK    771 - 840
QPEDDSSQAFISTQNGSPRLNRAEVPARPAPQEPYDVVLQRKENEGFGFVILTSKNKPPPGVIPHKIGRV    841 - 910
IEGSPADRCGKLKVGDHISAVNGQSIVELSHDNIVQLIKDAGVTVTLTVIAEEEHHGPPSGTNSARQSPA    911 - 980
LQHRPMGQSQANHIPGDRSALEGEIGKDVSTSYRHSWSDHKHLAQPDTAVISVVGSRHNQNLGCYPVELE    981 - 1050
RGPRGFGFSLRGGKEYNMGLFILRLAEDGPAIKDGRIHVGDQIVEINGEPTQGITHTRAIELIQAGGNKV   1051 - 1120
LLLLRPGTGLIPDHGDWDINNPSSSNVIYDEQSPLPPSSHFASIFEESHVPVIEESLRVQICEKAEELKD   1121 - 1190
IVPEKKSTLNENQPEIKHQSLLQKNVSKRDPPSSHGHSNKKNLLKVENGVTRRGRSVSPKKPASQHSEEH   1191 - 1260
LDKIPSPLKNNPKRRPRDQSLSPSKGENKSCQVSTRAGSGQDQCRKSRGRSASPKKQQKIEGSKAPSNAE   1261 - 1330
AKLLEGKSRRIAGYTGSNAEQIPDGKEKSDVIRKDAKQNQLEKSRTRSPEKKIKRMVEKSLPSKMTNKTT   1331 - 1400
SKEVSENEKGKKVTTGETSSSNDKIGENVQLSEKRLKQEPEEKVVSNKTEDHKGKELEAADKNKETGRFK   1401 - 1470
PESSSPVKKTLITPGPWKVPSGNKVTGTIGMAEKRQ                                     1471 - 1506
//

Text Mined References (31)

PMID Year Title
26452219 2015 MAGI3 negatively regulates Wnt/?-catenin signaling and suppresses malignant phenotypes of glioma cells.
26248734 2015 MAGI3 Suppresses Glioma Cell Proliferation via Upregulation of PTEN Expression.
24586183 2014 Identification of novel genetic Loci associated with thyroid peroxidase antibodies and clinical thyroid disease.
23568457 2013 Genetic variants associated with disordered eating.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21134377 2011 MAGI-3 competes with NHERF-2 to negatively regulate LPA2 receptor signaling in colon cancer cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20353789 2010 Beta-2 adrenergic receptor mediated ERK activation is regulated by interaction with MAGI-3.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18518978 2008 Comparison of p53 and the PDZ domain containing protein MAGI-3 regulation by the E6 protein from high-risk human papillomaviruses.
17934525 2008 HPV E6 degradation of p53 and PDZ containing substrates in an E6AP null background.
17055267 2007 Rational design of a nonpeptide general chemical scaffold for reversible inhibition of PDZ domain interactions.
16964398 2006 EG-1 interacts with c-Src and activates its signaling pathway.
16904289 2007 MAGI-3 regulates LPA-induced activation of Erk and RhoA.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16316992 2006 Proteomic analysis of beta1-adrenergic receptor interactions with PDZ scaffold proteins.
15652357 2005 Identification of MAGI-3 as a transforming growth factor-alpha tail binding protein.
15507623 2004 Role of the PDZ domain-binding motif of the oncoprotein E6 in the pathogenesis of human papillomavirus type 31.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15378012 2004 HPV E6 specifically targets different cellular pools of its PDZ domain-containing tumour suppressor substrates for proteasome-mediated degradation.
15195140 2004 MAGI-3 is involved in the regulation of the JNK signaling pathway as a scaffold protein for frizzled and Ltap.
15003862 2004 Human T-cell leukemia virus type 1 Tax oncoprotein induces and interacts with a multi-PDZ domain protein, MAGI-3.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12615970 2003 Junctional protein MAGI-3 interacts with receptor tyrosine phosphatase beta (RPTP beta) and tyrosine-phosphorylated proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421765 2002 Protein-protein interactions between large proteins: two-hybrid screening using a functionally classified library composed of long cDNAs.
12140759 2002 Oncogenic human papillomavirus E6 proteins target the MAGI-2 and MAGI-3 proteins for degradation.
11969287 2002 MAGI-1: a widely expressed, alternatively spliced tight junction protein.
10997877 2000 Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
10748157 2000 Interaction of the tumor suppressor PTEN/MMAC with a PDZ domain of MAGI3, a novel membrane-associated guanylate kinase.