Property Summary

NCBI Gene PubMed Count 49
PubMed Score 31.61
PubTator Score 38.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
urothelial carcinoma -1.400 3.7e-02
ependymoma 1.200 2.2e-02
oligodendroglioma 1.300 3.6e-03
psoriasis -1.700 2.3e-04
atypical teratoid / rhabdoid tumor -2.200 6.9e-05
medulloblastoma, large-cell -2.200 8.2e-05
Atopic dermatitis -1.200 1.3e-04
colon cancer -2.300 1.6e-03
lung cancer -1.800 9.2e-03
active ulcerative colitis -1.291 2.6e-02
interstitial cystitis -1.100 2.5e-02
subependymal giant cell astrocytoma -1.424 4.8e-02
breast carcinoma -1.100 1.1e-15
Breast cancer -1.300 3.2e-03
ductal carcinoma in situ -1.200 4.6e-02
ovarian cancer -1.900 4.0e-07
chronic rhinosinusitis -1.256 1.2e-02

Protein-protein Interaction (1)

Gene RIF (22)

PMID Text
25517131 MAGI2, SERPINE2, and NT5C3B expression levels are associated with airway wall thickening and additionally with bronchial inflammation, emphysema, and lung function, respectively, all features of chronic obstructive pulmonary disease.
24985972 The expression of MAGI2 mRNA was significantly down-regulated in PC3, LNCaP and DU-145 PCa cell lines.
24608321 In Usher syndrome 1G, mutations in SANS eliminate Magi2 binding and thereby deregulate endocytosis, lead to defective ciliary transport modules and ultimately disrupt photoreceptor cell function inducing retinal degeneration.
24258346 Data show that the miR-134/487b/655 cluster regulates TGF-beta1-induced epithelial-mesenchymal transition and affected the resistance to gefitinib by directly targeting membrane-associated guanylate kinase, WW, and PDZ domain-containing protein 2 (MAGI2).
23754155 MAGI2 enhances the sensitivity of BEL-7404 human hepatocellular carcinoma cells to staurosporine-induced apoptosis by increasing PTEN stability.
22649501 Common variants in MAGI2 gene are associated with increased risk for cognitive impairment in schizophrenic patients.
22381734 Results presented herein provide further evidence for a role of MAGI2 in bipolar affective disorder and schizophrenia etiology.
21515326 there was no association of MAGI2 and PARD3 with IBD.
20668459 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20101691 analysis of 7q11.21-q11.23 and infantile spasms without deletion of MAGI2 [case report]
20096742 Observational study of gene-disease association. (HuGE Navigator)
19948740 Data show that AIP1 is a novel GTPase-activating protein for Arf6, a small GTPase regulating cellular PIP(2) production and formation of the TLR4-TIRAP-MyD88 complex.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
18720471 MAGI2 genetic variation is associated with inflammatory bowel disease.
18720471 Observational study of gene-disease association. (HuGE Navigator)
18565486 Interstitial deletions that include the MAGI2 gene on chromosome 7q11.23-q.21.11 are associated with IS cases.
17989107 Observational study of gene-disease association. (HuGE Navigator)
17880912 PTEN plays a critical role in MAGI-2-induced inhibition of cell migration and proliferation in human hepatocarcinoma cells

AA Sequence

MSKSLKKKSHWTSKVHESVIGRNPEGQLGFELKGGAENGQFPYLGEVKPGKVAYESGSKLVSEELLLEVN      1 - 70
ETPVAGLTIRDVLAVIKHCKDPLRLKCVKQGGIVDKDLRHYLNLRFQKGSVDHELQQIIRDNLYLRTVPC     71 - 140
TTRPHKEGEVPGVDYIFITVEDFMELEKSGALLESGTYEDNYYGTPKPPAEPAPLLLNVTDQILPGATPS    141 - 210
AEGKRKRNKSVSNMEKASIEPPEEEEEERPVVNGNGVVVTPESSEHEDKSAGASGEMPSQPYPAPVYSQP    211 - 280
EELKEQMDDTKPTKPEDNEEPDPLPDNWEMAYTEKGEVYFIDHNTKTTSWLDPRLAKKAKPPEECKENEL    281 - 350
PYGWEKIDDPIYGTYYVDHINRRTQFENPVLEAKRKLQQHNMPHTELGTKPLQAPGFREKPLFTRDASQL    351 - 420
KGTFLSTTLKKSNMGFGFTIIGGDEPDEFLQVKSVIPDGPAAQDGKMETGDVIVYINEVCVLGHTHADVV    421 - 490
KLFQSVPIGQSVNLVLCRGYPLPFDPEDPANSMVPPLAIMERPPPVMVNGRHNYETYLEYISRTSQSVPD    491 - 560
ITDRPPHSLHSMPTDGQLDGTYPPPVHDDNVSMASSGATQAELMTLTIVKGAQGFGFTIADSPTGQRVKQ    561 - 630
ILDIQGCPGLCEGDLIVEINQQNVQNLSHTEVVDILKDCPIGSETSLIIHRGGFFSPWKTPKPIMDRWEN    631 - 700
QGSPQTSLSAPAIPQNLPFPPALHRSSFPDSTEAFDPRKPDPYELYEKSRAIYESRQQVPPRTSFRMDSS    701 - 770
GPDYKELDVHLRRMESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRY    771 - 840
VIDLMHHAARNGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYTNSNHAAPSSNASPPEG    841 - 910
FASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGSTITVPHKIGRIIDGSPADRCAKLKVGDRILAVNG    911 - 980
QSIINMPHADIVKLIKDAGLSVTLRIIPQEELNSPTSAPSSEKQSPMAQQSPLAQQSPLAQPSPATPNSP    981 - 1050
IAQPAPPQPLQLQGHENSYRSEVKARQDVKPDIRQPPFTDYRQPPLDYRQPPGGDYQQPPPLDYRQPPLL   1051 - 1120
DYRQHSPDTRQYPLSDYRQPQDFDYFTVDMEKGAKGFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRV   1121 - 1190
GDQIIEINGESTRDMTHARAIELIKSGGRRVRLLLKRGTGQVPEYDEPAPWSSPAAAAPGLPEVGVSLDD   1191 - 1260
GLAPFSPSHPAPPSDPSHQISPGPTWDIKREHDVRKPKELSACGQKKQRLGEQRERSASPQRAARPRLEE   1261 - 1330
APGGQGRPEAGRPASEARAPGLAAADAADAARAGGKEAPRAAAGSELCRREGPGAAPAFAGPGGGGSGAL   1331 - 1400
EAEGRAGARAGPRPGPRPPGGAPARKAAVAPGPWKVPGSDKLPSVLKPGASAASR                  1401 - 1455
//

Text Mined References (52)

PMID Year Title
25517131 2015 Novel genes for airway wall thickness identified with combined genome-wide association and expression analyses.
25342443 2014 Genome-wide association study identifies multiple loci associated with both mammographic density and breast cancer risk.
24985972 2014 Expression profile of MAGI2 gene as a novel biomarker in combination with major deregulated genes in prostate cancer.
24608321 2014 Phosphorylation of the Usher syndrome 1G protein SANS controls Magi2-mediated endocytosis.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24258346 2014 MiR-134/487b/655 cluster regulates TGF-?-induced epithelial-mesenchymal transition and drug resistance to gefitinib by targeting MAGI2 in lung adenocarcinoma cells.
23897914 2013 A genome-wide association study (GWAS) for bronchopulmonary dysplasia.
23754155 2013 MAGI2 enhances the sensitivity of BEL-7404 human hepatocellular carcinoma cells to staurosporine-induced apoptosis by increasing PTEN stability.
23751499 2013 The adhesion protein IgSF9b is coupled to neuroligin 2 via S-SCAM to promote inhibitory synapse development.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23007406 2012 Genome-wide association study identifies germline polymorphisms associated with relapse of childhood acute lymphoblastic leukemia.
22649501 2012 Common variants in MAGI2 gene are associated with increased risk for cognitive impairment in schizophrenic patients.
22381734 2012 MAGI1 copy number variation in bipolar affective disorder and schizophrenia.
22041458 2012 Pharmacogenomic study of side-effects for antidepressant treatment options in STAR*D.
21515326 2011 Replication of genetic variation in the MYO9B gene in Crohn's disease.
20966902 2011 Genome-wide association study of anthropometric traits and evidence of interactions with age and study year in Filipino women.
20668459 2010 Genetic variants that affect length/height in infancy/early childhood in Vietnamese-Korean families.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20534871 2011 Planar cell polarity pathway regulates actin rearrangement, cell shape, motility, and nephrin distribution in podocytes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20101691 2010 Deletion of 7q11.21-q11.23 and infantile spasms without deletion of MAGI2.
20096742 2010 Intestinal barrier gene variants may not explain the increased levels of antigliadin antibodies, suggesting other mechanisms than altered permeability.
19948740 2010 AIP1 functions as Arf6-GAP to negatively regulate TLR4 signaling.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19668339 2009 Hippocampal atrophy as a quantitative trait in a genome-wide association study identifying novel susceptibility genes for Alzheimer's disease.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18720471 2009 MAGI2 genetic variation and inflammatory bowel disease.
18565486 2008 Infantile spasms is associated with deletion of the MAGI2 gene on chromosome 7q11.23-q21.11.
17989107 2008 Associations with tight junction genes PARD3 and MAGI2 in Dutch patients point to a common barrier defect for coeliac disease and ulcerative colitis.
17880912 2007 MAGI-2 Inhibits cell migration and proliferation via PTEN in human hepatocarcinoma cells.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16464232 2006 Postsynaptic recruitment of Dendrin depends on both dendritic mRNA transport and synaptic anchoring.
16316992 2006 Proteomic analysis of beta1-adrenergic receptor interactions with PDZ scaffold proteins.
15652357 2005 Identification of MAGI-3 as a transforming growth factor-alpha tail binding protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15122254 2004 Mutant small heat-shock protein 27 causes axonal Charcot-Marie-Tooth disease and distal hereditary motor neuropathy.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12589829 2003 PKC regulates the delta2 glutamate receptor interaction with S-SCAM/MAGI-2 protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421765 2002 Protein-protein interactions between large proteins: two-hybrid screening using a functionally classified library composed of long cDNAs.
11826105 2002 Interaction of synaptic scaffolding molecule and Beta -catenin.
11707428 2001 Phosphorylation of the PTEN tail acts as an inhibitory switch by preventing its recruitment into a protein complex.
11526121 2001 beta 1-adrenergic receptor association with the synaptic scaffolding protein membrane-associated guanylate kinase inverted-2 (MAGI-2). Differential regulation of receptor internalization by MAGI-2 and PSD-95.
10760291 2000 Evidence for regulation of the PTEN tumor suppressor by a membrane-localized multi-PDZ domain containing scaffold protein MAGI-2.
10681527 2000 Identification and characterization of a PDZ protein that interacts with activin type II receptors.
10548487 1999 nRap GEP: a novel neural GDP/GTP exchange protein for rap1 small G protein that interacts with synaptic scaffolding molecule (S-SCAM).
10080919 1999 Interaction of S-SCAM with neural plakophilin-related Armadillo-repeat protein/delta-catenin.
9847074 1998 Toward a complete human genome sequence.
9734811 1998 Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
9647693 1998 Atrophin-1, the DRPLA gene product, interacts with two families of WW domain-containing proteins.