Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.50
PubTator Score 2.08

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.100 1.0e-03
atypical teratoid / rhabdoid tumor -1.500 5.5e-06
ependymoma -1.100 2.7e-05
group 3 medulloblastoma -1.200 1.5e-02
medulloblastoma, large-cell -1.700 6.6e-07
primitive neuroectodermal tumor -1.300 5.8e-03

AA Sequence

MSLVSQNARHCSAEITADYGDGRGEIQATNASGSPTSMLVVDAPQCPQAPINSQCVNTSQAVQDPNDLEV      1 - 70
LIDEQSRRLGALRVHDPLEDRSIALVNFMRMKSQTEGSIQQSEMLEFLREYSDQFPEILRRASAHLDQVF     71 - 140
GLNLRVIDPQADTYNLVSKRGFQITDRIAESLDMPKASLLALVLGHILLNGNRAREASIWDLLLKVDMWD    141 - 210
KPQRINNLFGNTRNLLTTDFVCMRFLEYWPVYGTNPLEFEFLWGSRAHREITKMEALKFVSDAHDEEPWS    211 - 280
WPEEYNKALEGDKTKERSLTAGLEFWSEDTMNDKANDLVQLAISVTEEMLPIHQDELLAHTGKEFEDVFP    281 - 350
NILNRATLILDMFYGLSLIEVDTSEHIYLLVQQPESEEEQVMLESLGRPTQEYVMPILGLIFLMGNRVKE    351 - 420
ANVWNLLRRFSVDVGRKHSITRKLMRQRYLECRPLSYSNPVEYELLWGPRAHHETIKMKVLEYMARLYRK    421 - 490
RPQNWPEQYREAVEDEEARAKSEATIMFFLDPT                                         491 - 523
//

Text Mined References (6)

PMID Year Title