Property Summary

NCBI Gene PubMed Count 12
PubMed Score 94.26
PubTator Score 6.13

Knowledge Summary


No data available


  Disease (1)

Disease Target Count Z-score Confidence
Melanoma 261 5.428 2.7
hepatocellular carcinoma 550 3.347 1.7


Gene RIF (5)

24068544 Overexpression of MAGE-D4 may be a predictive marker of early recurrence and mortality in patients with hepatocellular carcinoma (HCC).
22459352 Our data suggest that MAGED4B over-expression is a driver in oral carcinogenesis
21618523 MAGE-D4B was found to correlate with tumor progression and to be an independent prognostic marker for poor outcome in term of relapse-free and overall survival, with potential predictive relevance in relation to response to chemotherapy
16225959 MAGE-D4 plays some roles in tumor cells proliferation in NSCLC, but MAGE-D4 expression status did not provided a prognostic significance.
11602350 The MAGE-E1 gene is composed of 13 exons, and three of these (exon 2, exon 3 and exon 12) are alternatively spliced in each variant (E1a-c). MAGE-E1 gene is located in Xp11 through the analysis of radiation hybrid panels.

AA Sequence

SSGTNGGASTSVLDGPSTSSTIRTRNAARAGASFFSWIQHR                                 701 - 741

Text Mined References (15)

PMID Year Title
24068544 2013 Evaluation of MAGE-D4 expression in hepatocellular carcinoma in Japanese patients.
22459352 2012 Over-expression of MAGED4B increases cell migration and growth in oral squamous cell carcinoma and is associated with poor disease outcome.
21618523 2012 MAGE-D4B is a novel marker of poor prognosis and potential therapeutic target involved in breast cancer tumorigenesis.
20864041 2010 MAGE-RING protein complexes comprise a family of E3 ubiquitin ligases.
16225959 2006 Expression of MAGE-D4, a novel MAGE family antigen, is correlated with tumor-cell proliferation of non-small cell lung cancer.
16082191 2005 MAGED4-expression in renal cell carcinoma and identification of an HLA-A*25-restricted MHC class I ligand from solid tumor tissue.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11602350 2001 Structural characterization and chromosomal localization of the MAGE-E1 gene.
11406556 2001 MAGE-E1, a new member of the melanoma-associated antigen gene family and its expression in human glioma.
11347906 2001 Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.