Property Summary

NCBI Gene PubMed Count 20
PubMed Score 59.68
PubTator Score 28.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (6)

Disease log2 FC p
Duchenne muscular dystrophy 1.215 1.9e-11
acute quadriplegic myopathy 1.038 1.7e-06
diabetes mellitus -1.800 1.2e-03
invasive ductal carcinoma 1.300 5.0e-03
ovarian cancer -1.200 1.5e-04
dermatomyositis 1.300 2.6e-03

Gene RIF (10)

PMID Text
27120771 We found that MAGED2 mutations caused X-linked polyhydramnios with prematurity and a severe but transient form of antenatal Bartter's syndrome.
26705694 MAGE-D2 is a dynamic protein whose shuttling properties could suggest a role in cell cycle regulation.
25743330 Increased expression of MAGE-D2 mRNA was associated with distant metastasis in Gastric Cancer.
22791814 these results identify the expression of MAGE-D2 suppresses TRAIL receptor 2 and protects againstas TRAIL-induced apoptosis
20237496 Observational study of gene-disease association. (HuGE Navigator)
18095154 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17912449 MAGED2, a novel protein, is a p53-dissociator.
15465002 Results identified a cDNA clone, corresponding to MAGE D2 mRNA, from primary human bronchial epithelial cells which exhibits increased expression in vitro after treatment with all-trans retinoic acid.
15162511 Maged2 is mainly expressed in tissues of mesodermal origin
11856887 Expression pattern and further characterization of human MAGED2 and identification of rodent orthologues

AA Sequence

MSDTSESGAGLTRFQAEASEKDSSSMMQTLLTVTQNVEVPETPKASKALEVSEDVKVSKASGVSKATEVS      1 - 70
KTPEAREAPATQASSTTQLTDTQVLAAENKSLAADTKKQNADPQAVTMPATETKKVSHVADTKVNTKAQE     71 - 140
TEAAPSQAPADEPEPESAAAQSQENQDTRPKVKAKKARKVKHLDGEEDGSSDQSQASGTTGGRRVSKALM    141 - 210
ASMARRASRGPIAFWARRASRTRLAAWARRALLSLRSPKARRGKARRRAAKLQSSQEPEAPPPRDVALLQ    211 - 280
GRANDLVKYLLAKDQTKIPIKRSDMLKDIIKEYTDVYPEIIERAGYSLEKVFGIQLKEIDKNDHLYILLS    281 - 350
TLEPTDAGILGTTKDSPKLGLLMVLLSIIFMNGNRSSEAVIWEVLRKLGLRPGIHHSLFGDVKKLITDEF    351 - 420
VKQKYLDYARVPNSNPPEYEFFWGLRSYYETSKMKVLKFACKVQKKDPKEWAAQYREAMEADLKAAAEAA    421 - 490
AEAKARAEIRARMGIGLGSENAAGPCNWDEADIGPWAKARIQAGAEAKAKAQESGSASTGASTSTNNSAS    491 - 560
ASASTSGGFSAGASLTATLTFGLFAGLGGAGASTSGSSGACGFSYK                            561 - 606
//

Text Mined References (34)

PMID Year Title
27120771 2016 Polyhydramnios, Transient Antenatal Bartter's Syndrome, and MAGED2 Mutations.
26705694 2016 Melanoma antigen-D2: A nucleolar protein undergoing delocalization during cell cycle and after cellular stress.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25743330 2016 The Expression of Melanoma-Associated Antigen D2 Both in Surgically Resected and Serum Samples Serves as Clinically Relevant Biomarker of Gastric Cancer Progression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22791814 2012 The melanoma-associated antigen MAGE-D2 suppresses TRAIL receptor 2 and protects against TRAIL-induced apoptosis in human melanoma cells.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18095154 2008 Use of expression data and the CGEMS genome-wide breast cancer association study to identify genes that may modify risk in BRCA1/2 mutation carriers.
18088087 2008 Phosphoproteome of resting human platelets.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17912449 2007 MAGED2: a novel p53-dissociator.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15465002 2004 Identification of a novel MAGE D2 antisense RNA transcript in human tissues.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15162511 2004 Comparative expression analysis of the MAGED genes during embryogenesis and brain development.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11856887 2001 Expression pattern and further characterization of human MAGED2 and identification of rodent orthologues.
10752678 2000 Isolation of genes overexpressed in freshly isolated breast cancer specimens.
10463614 1999 A new MAGE gene with ubiquitous expression does not code for known MAGE antigens recognized by T cells.