Property Summary

NCBI Gene PubMed Count 40
PubMed Score 43.36
PubTator Score 36.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
psoriasis 1.400 1.6e-04
osteosarcoma 1.660 1.1e-04
astrocytoma 1.400 2.1e-02
Duchenne muscular dystrophy 1.116 3.1e-09
acute quadriplegic myopathy 1.110 8.2e-06
non-small cell lung cancer 1.237 3.7e-17
diabetes mellitus -1.100 1.1e-02
Breast cancer 2.300 4.3e-02
lung carcinoma 1.200 3.9e-18
ductal carcinoma in situ 1.400 3.0e-04
ovarian cancer 2.500 8.7e-06

Protein-protein Interaction (6)

Gene RIF (18)

PMID Text
24710624 High NRAGE expression is associated with esophageal carcinomas.
23314527 MAGE-D1 plays important roles in the central nervous system in both developmental and adult stages.
22935435 Univariate and multivariate analyses indicated that MAGED1 expression was an independent prognostic factor in colorectal carcinoma
21109781 we establish the roles for Dlxin-1, one as an anti-tumorigenic and anti-invasive protein in high-grade gliomas and the other as an inducer of differentiation of glioma stem cells.
20868560 NRAGE may participate in the formation of radioresistance of TE13R120 cells by changing its subcellular localization, but its relationship with cell apoptosis has not been confirmed.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20100315 Data report that NRAGE, via the same XIAP-Tak1-Tab1 complex, is required for the phosphorylation of IKK -alpha/beta and subsequent transcriptional activation of the p65 subunit of NF-kappaB.
19639218 Enhanced expression of MAGE-D1 by gene transfer could reverse the malignant phenotypes of breast cancer cells.
17488777 Che-1 interacts with NRAGE and NRAGE overexpression downregulates endogenous Che-1 by targeting it for proteasome-dependent degradation.
17453828 These findings provide new insight into the ability of MAGE-D1 to suppress the motility and adhesion response of tumor cells by interfering with actin cytoskeleton reorganization and hypoxia inducible factor 1-dependent gene expression.
17149546 MAGE-D1 might be a novel inhibitor of angiogenesis in vitro and in vivo.
17140727 studies indicate for the first time that NRAGE could suppress metastasis of melanoma and pancreatic cancer probably through downregulation of MMP-2
16388736 Data show that hNRAGE gene can inhibit the growth of 293 cells.
16125672 demonstrate the importance of human NRAGE in homotypic cell-to-cell adhesion and illuminate the mechanism of human NRAGE in the process of inhibition of cell adhesion
15930293 MAGE-D1 protein expression was reduced in 6 of 16 breast carcinoma cell lines as compared with untransformed immortal mammary epithelial cell lines; suppression of MAGE-D1 expression may be involved in the tumorigenesis of some sporadic breast cancers.
15162511 The expression pattern of Maged1 roughly summarizes that of Maged2 and Maged3
15094062 hNRAGE arrests cell growth through a p53 dependent pathway. hNRAGE also increases the p53 protein level as well as its phosphorylation (Ser392).
11959851 A RING finger protein Praja1 regulates Dlx5-dependent transcription through its ubiquitin ligase activity for the Dlx/Msx-interacting MAGE/Necdin family protein, Dlxin-1.

AA Sequence

MAQKMDCGAGLLGFQAEASVEDSALLMQTLMEAIQISEAPPTNQATAAASPQSSQPPTANEMADIQVSAA      1 - 70
AARPKSAFKVQNATTKGPNGVYDFSQAHNAKDVPNTQPKAAFKSQNATPKGPNAAYDFSQAATTGELAAN     71 - 140
KSEMAFKAQNATTKVGPNATYNFSQSLNANDLANSRPKTPFKAWNDTTKAPTADTQTQNVNQAKMATSQA    141 - 210
DIETDPGISEPDGATAQTSADGSQAQNLESRTIIRGKRTRKINNLNVEENSSGDQRRAPLAAGTWRSAPV    211 - 280
PVTTQNPPGAPPNVLWQTPLAWQNPSGWQNQTARQTPPARQSPPARQTPPAWQNPVAWQNPVIWPNPVIW    281 - 350
QNPVIWPNPIVWPGPVVWPNPLAWQNPPGWQTPPGWQTPPGWQGPPDWQGPPDWPLPPDWPLPPDWPLPT    351 - 420
DWPLPPDWIPADWPIPPDWQNLRPSPNLRPSPNSRASQNPGAAQPRDVALLQERANKLVKYLMLKDYTKV    421 - 490
PIKRSEMLRDIIREYTDVYPEIIERACFVLEKKFGIQLKEIDKEEHLYILISTPESLAGILGTTKDTPKL    491 - 560
GLLLVILGVIFMNGNRASEAVLWEALRKMGLRPGVRHPLLGDLRKLLTYEFVKQKYLDYRRVPNSNPPEY    561 - 630
EFLWGLRSYHETSKMKVLRFIAEVQKRDPRDWTAQFMEAADEALDALDAAAAEAEARAEARTRMGIGDEA    631 - 700
VSGPWSWDDIEFELLTWDEEGDFGDPWSRIPFTFWARYHQNARSRFPQTFAGPIIGPGGTASANFAANFG    701 - 770
AIGFFWVE                                                                  771 - 778
//

Text Mined References (42)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24710624 2014 NRAGE promotes cell proliferation by stabilizing PCNA in a ubiquitin-proteasome pathway in esophageal carcinomas.
23314527 2013 The roles of MAGE-D1 in the neuronal functions and pathology of the central nervous system.
22935435 2012 Prognostic relevance of melanoma antigen D1 expression in colorectal carcinoma.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21109781 2011 Dlxin-1, a member of MAGE family, inhibits cell proliferation, invasion and tumorigenicity of glioma stem cells.
20868560 2010 Relationship between NRAGE and the radioresistance of esophageal carcinoma cell line TE13R120.
20864041 2010 MAGE-RING protein complexes comprise a family of E3 ubiquitin ligases.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20100315 2010 A role for NRAGE in NF-kappaB activation through the non-canonical BMP pathway.
19639218 2009 MAGE-D1 inhibits proliferation, migration and invasion of human breast cancer cells.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17488777 2007 NRAGE associates with the anti-apoptotic factor Che-1 and regulates its degradation to induce cell death.
17453828 Melanoma-associated antigen family protein-D1 regulation of tumor cell migration, adhesion to endothelium, and actin structures reorganization in response to hypoxic stress.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17149546 2007 Inhibition of adenovirus-mediated human MAGE-D1 on angiogenesis in vitro and in vivo.
17140727 2007 NRAGE suppresses metastasis of melanoma and pancreatic cancer in vitro and in vivo.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16388736 2006 [Construction of recombinant adenovirus vector of hNRAGE gene and its effect on cell cycle of 293 cells].
16125672 2005 Human NRAGE disrupts E-cadherin/beta-catenin regulated homotypic cell-cell adhesion.
16000308 2005 Novel interaction partners of the CD2BP2-GYF domain.
15930293 2005 BRCA2 suppresses cell proliferation via stabilizing MAGE-D1.
15772651 2005 The DNA sequence of the human X chromosome.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15162511 2004 Comparative expression analysis of the MAGED genes during embryogenesis and brain development.
15094062 2004 hNRAGE, a human neurotrophin receptor interacting MAGE homologue, regulates p53 transcriptional activity and inhibits cell proliferation.
12787561 Ten years on: mediation of cell death by the common neurotrophin receptor p75(NTR).
12754255 2003 The receptor tyrosine kinase Ror2 associates with the melanoma-associated antigen (MAGE) family protein Dlxin-1 and regulates its intracellular distribution.
12598531 2003 UNC5H1 induces apoptosis via its juxtamembrane region through an interaction with NRAGE.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12376548 2002 NRAGE, a p75 neurotrophin receptor-interacting protein, induces caspase activation and cell death through a JNK-dependent mitochondrial pathway.
12204258 2002 Expression analysis of a novel p75(NTR) signaling protein, which regulates cell cycle progression and apoptosis.
12023963 2002 Involvement of TRAF4 in oxidative activation of c-Jun N-terminal kinase.
11959851 2002 A RING finger protein Praja1 regulates Dlx5-dependent transcription through its ubiquitin ligase activity for the Dlx/Msx-interacting MAGE/Necdin family protein, Dlxin-1.
11546791 2001 Neurotrophin receptor-interacting mage homologue is an inducible inhibitor of apoptosis protein-interacting protein that augments cell death.
11313144 2001 MAGE-F1, a novel ubiquitously expressed member of the MAGE superfamily.
11280991 2001 [A new melanoma antigen-encoding gene subfamily in human chromosome X].
11087672 2000 Identification of the translational initiation codon in human MAGED1.
11084035 2001 Dlxin-1, a novel protein that binds Dlx5 and regulates its transcriptional function.
10985348 2000 NRAGE, a novel MAGE protein, interacts with the p75 neurotrophin receptor and facilitates nerve growth factor-dependent apoptosis.
10409427 1999 Identification of a new, unorthodox member of the MAGE gene family.