Property Summary

NCBI Gene PubMed Count 36
PubMed Score 95.87
PubTator Score 13.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
malignant mesothelioma 3163 3.3e-09
lung cancer 4473 8.1e-04
diabetes mellitus 1663 1.7e-03
non primary Sjogren syndrome sicca 840 1.7e-02
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 3.937 2.0

Synonym

Accession Q9UBF1 Q5JZ00 Q96D45 Q9P1M6 Q9P1M7
Symbols CT10
HCA587
MAGEE1

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (23)

PMID Text
26540345 Data show that melanoma antigen, family C, 2 protein (MAGE-C2) binds with RING-box protein 1 (Rbx1) and Cullin 1, and regulates cyclin E stability in melanoma cells.
26321295 MAGE-C1 and MAGE-C2 expressions were positively associated with high tumor grade and reduced recurrence-free survival in breast cancer.
26161400 expression of CT7 and CT10 throughout the different subtypes of mucosal melanoma and tumor development.
24866244 overexpression of HCA587 resulted in a significant enhancement of LMP1-induced IL-6 production. These data indicate that HCA587 is a new negative regulator of BS69
24820892 MAGE-C1 and MAGE-C2 are expressed in myeloma, but the chromosome aberrations do not always correlate with expression
24713551 In gastrointestinal stromal tumors, 5/51 (10%) patients expressed MAGE-C2. High-grade GIST are more likely to express MAGE-C2. MAGE-C2 also significantly correlates with mitotic rate and tumor size.
24687377 Our results indicate that MAGEC2 has a role in breast cancer metastasis through inducing epithelial-mesenchymal transition
23180015 the present study confirmed MAGE-C1/CT7 and MAGE-C2/CT7 expression in monoclonal gammopathies
23096706 MAGE-C2 promotes growth and tumorigenicity of melanoma cells, phosphorylation of KAP1, and DNA damage repair.
22925930 Cytotoxic T cell clones directed against MAGE-C2 peptides recognize EB81-melanoma tumor cells treated with interferon (IotaFN)-gamma.
21876767 Expression of MAGE I proteins, MAGE-A3 or MAGE-C2, relieved repression of a reporter gene by ZNF382 and MAGE I expression relieved KAP1 mediated ID1 repression.
21780320 MAGEC2 is a sensitive and novel marker for seminoma.
21754986 MAGE-C2/CT10 expression in prostate cancer correlates with the degree of malignancy and indicates a higher risk for biochemical recurrence after radical prostatectomy.
21738656 Results suggest that the expression of MAGE-C1/CT7 and MAGE-C2/CT10 in primary melanoma is a potent predictor of sentinel lymph node metastasis.
21595801 p43-57 is the first HCA587-derived major histocompatibility complex class II-restricted epitope to fulfil all prerequisites for use as a peptide vaccine in patients with HCA587-expressing tumors
20862285 Observational study of gene-disease association. (HuGE Navigator)
20621094 a content of >/=50% MAGE-C1/CT7 expressing myeloma cells in a sample was associated with reduced overall survival (p=0.013).
18942708 MAGE-C2/CT-10 is expressed in hepatocellular carcinoma
17495964 the MAGE-A3 and MAGE-C2 gene promoter regions are de-methylated in the presence of activated KIT but become methylated on inhibition of KIT, consistent with the downregulation of mRNA and protein
17096150 because of the expression pattern of gene MAGE-C2, this new antigen is strictly tumor-specific
15061963 CT10 expression was more frequently found in squamous cell carcinoma than in adenocarcinoma.
14999777 identified 2 antigens encoded by gene MAGE-C2 which are recognized by several melanoma-specific cytolytic T lymphocyte clones isolated from a melanoma patient; both antigens are presented by HLA-A2
12920247 HCA 587 may be a valuable target antigen for diagnosis and vaccination of hepatocelular carcinoma patients.

AA Sequence

MPPVPGVPFRNVDNDSPTSVELEDWVDAQHPTDEEEEEASSASSTLYLVFSPSSFSTSSSLILGGPEEEE      1 - 70
VPSGVIPNLTESIPSSPPQGPPQGPSQSPLSSCCSSFSWSSFSEESSSQKGEDTGTCQGLPDSESSFTYT     71 - 140
LDEKVAELVEFLLLKYEAEEPVTEAEMLMIVIKYKDYFPVILKRAREFMELLFGLALIEVGPDHFCVFAN    141 - 210
TVGLTDEGSDDEGMPENSLLIIILSVIFIKGNCASEEVIWEVLNAVGVYAGREHFVYGEPRELLTKVWVQ    211 - 280
GHYLEYREVPHSSPPYYEFLWGPRAHSESIKKKVLEFLAKLNNTVPSSFPSWYKDALKDVEERVQATIDT    281 - 350
ADDATVMASESLSVMSSNVSFSE                                                   351 - 373
//

Text Mined References (40)

PMID Year Title
26540345 2015 Cancer-testis antigen MAGE-C2 binds Rbx1 and inhibits ubiquitin ligase-mediated turnover of cyclin E.
26321295 2016 The expression of MAGE-C1 and MAGE-C2 in breast cancer and their clinical significance.
26161400 2015 Intratumoral Heterogeneity of MAGE-C1/CT7 and MAGE-C2/CT10 Expression in Mucosal Melanoma.
25416956 2014 A proteome-scale map of the human interactome network.
24866244 2014 Cancer-testis antigen HCA587/MAGE-C2 interacts with BS69 and promotes its degradation in the ubiquitin-proteasome pathway.
24820892 2015 Chromosomal aberrations of cancer-testis antigens in myeloma patients.
24713551 2014 Expression of cancer testis antigens CT10 (MAGE-C2) and GAGE in gastrointestinal stromal tumors.
24687377 2014 MAGEC2, an epithelial-mesenchymal transition inducer, is associated with breast cancer metastasis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23180015 2013 MAGE-C1/CT7 and MAGE-C2/CT10 are frequently expressed in multiple myeloma and can be explored in combined immunotherapy for this malignancy.
23096706 2013 MAGE-C2 promotes growth and tumorigenicity of melanoma cells, phosphorylation of KAP1, and DNA damage repair.
22925930 2012 Analysis of the processing of seven human tumor antigens by intermediate proteasomes.
22808956 2012 Genetically distinct subsets within ANCA-associated vasculitis.
21876767 2011 MAGE I transcription factors regulate KAP1 and KRAB domain zinc finger transcription factor mediated gene repression.
21780320 2011 MAGEC2 is a sensitive and novel marker for seminoma: a tissue microarray analysis of 325 testicular germ cell tumors.
21754986 2011 MAGE-C2/CT10 protein expression is an independent predictor of recurrence in prostate cancer.
21738656 2011 Expression of MAGE-C1/CT7 and MAGE-C2/CT10 predicts lymph node metastasis in melanoma patients.
21595801 2011 Identification of promiscuous HLA-DR-restricted CD4? T-cell epitopes on the cancer-testis antigen HCA587.
21277283 2011 Identification of novel small molecules that inhibit protein-protein interactions between MAGE and KAP-1.
21269460 2011 Initial characterization of the human central proteome.
20864041 2010 MAGE-RING protein complexes comprise a family of E3 ubiquitin ligases.
20862285 2010 Frequent MAGE mutations in human melanoma.
20621094 2010 Expression and prognostic relevance of MAGE-C1/CT7 and MAGE-C2/CT10 in osteolytic lesions of patients with multiple myeloma.
18942708 2009 Frequent expression of the novel cancer testis antigen MAGE-C2/CT-10 in hepatocellular carcinoma.
17942928 2007 MAGE-A, mMage-b, and MAGE-C proteins form complexes with KAP1 and suppress p53-dependent apoptosis in MAGE-positive cell lines.
17495964 2007 Epigenetic control of MAGE gene expression by the KIT tyrosine kinase.
17096150 2007 A new tumor-specific antigen encoded by MAGE-C2 and presented to cytolytic T lymphocytes by HLA-B44.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15061963 2004 [Expression of multiple cancer-testis antigen genes in non-small cell lung cancer treated by chemotherapy prior surgery].
14999777 2004 Two new tumor-specific antigenic peptides encoded by gene MAGE-C2 and presented to cytolytic T lymphocytes by HLA-A2.
12920247 2003 HCA587 antigen expression in normal tissues and cancers: correlation with tumor differentiation in hepatocellular carcinoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12097419 2002 Large scale identification of human hepatocellular carcinoma-associated antigens by autoantibodies.
11602350 2001 Structural characterization and chromosomal localization of the MAGE-E1 gene.
11406556 2001 MAGE-E1, a new member of the melanoma-associated antigen gene family and its expression in human glioma.
10861452 2000 MAGE-B5, MAGE-B6, MAGE-C2, and MAGE-C3: four new members of the MAGE family with tumor-specific expression.
10699956 2000 CT10: a new cancer-testis (CT) antigen homologous to CT7 and the MAGE family, identified by representational-difference analysis.