Property Summary

NCBI Gene PubMed Count 40
PubMed Score 97.00
PubTator Score 13.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
malignant mesothelioma 3232 3.3e-09
diabetes mellitus 1728 1.7e-03
non primary Sjogren syndrome sicca 891 1.7e-02
lung cancer 4740 1.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2499 3.974 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 1.300 1.9e-02
diabetes mellitus 1.300 1.7e-03
malignant mesothelioma -6.900 3.3e-09
non primary Sjogren syndrome sicca -1.200 1.7e-02

Gene RIF (27)

AA Sequence

MPPVPGVPFRNVDNDSPTSVELEDWVDAQHPTDEEEEEASSASSTLYLVFSPSSFSTSSSLILGGPEEEE      1 - 70
VPSGVIPNLTESIPSSPPQGPPQGPSQSPLSSCCSSFSWSSFSEESSSQKGEDTGTCQGLPDSESSFTYT     71 - 140
LDEKVAELVEFLLLKYEAEEPVTEAEMLMIVIKYKDYFPVILKRAREFMELLFGLALIEVGPDHFCVFAN    141 - 210
TVGLTDEGSDDEGMPENSLLIIILSVIFIKGNCASEEVIWEVLNAVGVYAGREHFVYGEPRELLTKVWVQ    211 - 280
GHYLEYREVPHSSPPYYEFLWGPRAHSESIKKKVLEFLAKLNNTVPSSFPSWYKDALKDVEERVQATIDT    281 - 350
ADDATVMASESLSVMSSNVSFSE                                                   351 - 373
//

Text Mined References (44)

PMID Year Title