Property Summary

NCBI Gene PubMed Count 15
PubMed Score 12.49
PubTator Score 13.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Gene RIF (5)

AA Sequence

MPRGQKSKLRAREKRRKARDETRGLNVPQVTEAEEEEAPCCSSSVSGGAASSSPAAGIPQEPQRAPTTAA      1 - 70
AAAAGVSSTKSKKGAKSHQGEKNASSSQASTSTKSPSEDPLTRKSGSLVQFLLYKYKIKKSVTKGEMLKI     71 - 140
VGKRFREHFPEILKKASEGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFPRRKLLMPLLGV    141 - 210
IFLNGNSATEEEIWEFLNMLGVYDGEEHSVFGEPWKLITKDLVQEKYLEYKQVPSSDPPRFQFLWGPRAY    211 - 280
AETSKMKVLEFLAKVNGTTPCAFPTHYEEALKDEEKAGV                                   281 - 319
//

Text Mined References (19)

PMID Year Title