Property Summary

NCBI Gene PubMed Count 45
PubMed Score 96.38
PubTator Score 104.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
non-small cell lung cancer 2798 1.5e-06
Disease Target Count Z-score Confidence
Cancer 2346 4.315 2.2

Gene RIF (30)

PMID Text
26910052 the crystal structures of MAGE-A3 and MAGE-A4
26191258 CTAs (MAGE-A4, NY-ESO-1, MAGE-A10) were more likely expressed in patients with squamous cell carcinoma of the lung and when CTAs combined with CD133, they can be better prognostic factors.
24238058 Expression of MAGE-A4 may make immunotherapeutic intervention possible in selected patients with thyroid cancer.
23172894 Mage-A4 expression and serum identification is and potential therapeutic target in estrogen receptor negative breast cancer.
23124547 HLA class I loss in smokers or patients with the MAGE-A4 gene was a prognostic factors in non-small cell lung cancer .
22842486 MAGEA4 promotes growth by preventing cell cycle arrest and by inhibiting apoptosis mediated by the p53 transcriptional targets.
22653756 Detection of MAGE-4 transcripts in blood may help to predict the prognosis and monitoring of the response of HCV-infected hepatocellular carcinoma patients to therapy
22323448 Cancer/testis antigens are novel targets of immunotherapy for adult T-cell leukemia/lymphoma.
22134685 Report MAGEA1-A6 expression in sputum suggests presence of lung cancer cells or precancerous cells.
21815906 novel HLA-A2-restricted T cell epitope derived from MAGE-4 was identified
21613820 MAGE-A4 is identified as a specific biomarker of esophageal squamous cell carcinoma with a possible oncogenic role contributing to tumor progression.
21556122 Primary tumors with and without lymph node metastases showed no significant differences in MAGE-A 3/4 (P=0.672) and NY-ESO-1 (P=0.444) expression
21452042 High MAGE-4 gene expression is associated with metastases in hepatitis C virus patients complicated by hepatocellular carcinoma.
21264495 RT-PCR assays of MAGE-A3 and MAGE-A4 in blood of breast cancer (BC) patients may have prognostic and predictive implications, and they are promising specific tumor markers of BC
20862285 Observational study of gene-disease association. (HuGE Navigator)
20715104 High MAGE-A4 gene expression is associated with head and neck squamous cell carcinoma
20591578 Report immunohistochemical expression of MAGE-A4 in renal oncocytoma and chromophobe renal cell carcinoma.
19545928 positive expression in patients with non-small cell lung cancer is associated with poorer overall survival
19533752 Overexpression of MAGE-A4 is associated with bladder cancer.
18982744 Its expression is significantly associated with prognostic factors in poor outcome of the non-small cell lung cancer.
18197853 Multiple simultaneous detection of MAGE-A [subtypes] more specific and sensitive than detection of single MAGE-A antigen for the diagnostic and prognostic evaluation of oral squamous cell carcinoma
17214847 Expressed in a large part of epithelial skin tumors with predominantly scattered immunoexpression pattern in organ-transplant recipients.
16596224 Expression may represent potential targets for cancer immunotherapy in patients with non small cell lung carcinoma.
16114059 Present, by immunocytochemistry, in normal prostate, prostatic hypertrophy and prostate cancer.
16061876 MAGE-A4(143-151) and SAGE(715-723) are HLA-A2402-restricted CTL epitopes
14739298 a cleaved form of MAGE-A4 binds to Miz-1 and induces apoptosis
12525503 MAGE-A4 binds to gankyrin and suppresses its oncogenic activity.
12209997 strong MAGE-A4 expression and to a lesser degree NY-ESO-1 expression is characteristic of the vast majority of uterine carcinosarcomas and a major subset of papillary serous carcinomas
12209610 MAGE-A4 expression in bladder transitional cell carcinoma.
11985796 MAGE-4 protein may have a role in development of hepatocellular carcinogenesis in cirrhotic patients

AA Sequence

MSSEQKSQHCKPEEGVEAQEEALGLVGAQAPTTEEQEAAVSSSSPLVPGTLEEVPAAESAGPPQSPQGAS      1 - 70
ALPTTISFTCWRQPNEGSSSQEEEGPSTSPDAESLFREALSNKVDELAHFLLRKYRAKELVTKAEMLERV     71 - 140
IKNYKRCFPVIFGKASESLKMIFGIDVKEVDPASNTYTLVTCLGLSYDGLLGNNQIFPKTGLLIIVLGTI    141 - 210
AMEGDSASEEEIWEELGVMGVYDGREHTVYGEPRKLLTQDWVQENYLEYRQVPGSNPARYEFLWGPRALA    211 - 280
ETSYVKVLEHVVRVNARVRIAYPSLREAALLEEEEGV                                     281 - 317
//

Text Mined References (49)

PMID Year Title
26910052 2016 Structures of Two Melanoma-Associated Antigens Suggest Allosteric Regulation of Effector Binding.
26191258 2015 Predictive and prognostic effect of CD133 and cancer-testis antigens in stage Ib-IIIA non-small cell lung cancer.
24238058 2013 Potential role of 5-aza-2'-deoxycytidine induced MAGE-A4 expression in immunotherapy for anaplastic thyroid cancer.
23172894 2013 Proteomic profiling of triple-negative breast carcinomas in combination with a three-tier orthogonal technology approach identifies Mage-A4 as potential therapeutic target in estrogen receptor negative breast cancer.
23124547 2013 Clinical significance of human leukocyte antigen loss and melanoma-associated antigen 4 expression in smokers of non-small cell lung cancer patients.
23092983 2012 Analysis of the chromosome X exome in patients with autism spectrum disorders identified novel candidate genes, including TMLHE.
22842486 2012 MAGEA4 induces growth in normal oral keratinocytes by inhibiting growth arrest and apoptosis.
22653756 2012 MAGE-4 gene m-RNA and TGF in blood as potential biochemical markers for HCC in HCV-infected patients.
22323448 2012 Cancer/testis antigens are novel targets of immunotherapy for adult T-cell leukemia/lymphoma.
22134685 2012 MAGE A1-A6 RT-PCR and MAGE A3 and p16 methylation analysis in induced sputum from patients with lung cancer and non-malignant lung diseases.
21815906 2011 Identification of a novel CD8+ T cell epitope derived from cancer-testis antigen MAGE-4 in oesophageal carcinoma.
21613820 2011 Cancer-testis gene expression profiling in esophageal squamous cell carcinoma: identification of specific tumor marker and potential targets for immunotherapy.
21556122 2011 MAGE-A3/4 and NY-ESO-1 antigens expression in metastatic esophageal squamous cell carcinoma.
21452042 2012 MAGE-3 and MAGE-4 genes as possible markers for early detection of metastases in hepatitis C virus Egyptian patients complicated by hepatocellular carcinoma.
21269460 2011 Initial characterization of the human central proteome.
21264495 2011 The melanoma-associated antigen-A3, -A4 genes: relation to the risk and clinicopathological parameters in breast cancer patients.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20862285 2010 Frequent MAGE mutations in human melanoma.
20715104 2011 Pattern and clinical significance of cancer-testis gene expression in head and neck squamous cell carcinoma.
20591578 2010 Immunohistochemical expression of tumor antigens MAGE-A3/4 and NY-ESO-1 in renal oncocytoma and chromophobe renal cell carcinoma.
19545928 2010 Clinical significance of cancer/testis antigens expression in patients with non-small cell lung cancer.
19533752 2009 High frequency of MAGE-A4 and MAGE-A9 expression in high-risk bladder cancer.
18982744 2008 Immunohystochemical expression of cancer/testis antigens (MAGE-A3/4, NY-ESO-1) in non-small cell lung cancer: the relationship with clinical-pathological features.
18197853 2008 Expression of melanoma-associated antigens in oral squamous cell carcinoma.
17214847 2007 Cancer/testis antigen MAGE-A4 expression pattern differs in epithelial skin tumors of organ-transplant recipients and immunocompetent patients.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16651421 2006 Melanoma antigen A4 is expressed in non-small cell lung cancers and promotes apoptosis.
16596224 2006 Expression of the MAGE-A4 and NY-ESO-1 cancer-testis antigens and T cell infiltration in non-small cell lung carcinoma and their prognostic significance.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16114059 2006 Immunohistochemical expression of tumor antigens MAGE-A1, MAGE-A3/4, and NY-ESO-1 in cancerous and benign prostatic tissue.
16061876 2005 Determination of cellularly processed HLA-A2402-restricted novel CTL epitopes derived from two cancer germ line genes, MAGE-A4 and SAGE.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14739298 2004 A cleaved form of MAGE-A4 binds to Miz-1 and induces apoptosis in human cells.
12759544 2003 Expression of cancer/testis tumor associated antigens in cervical squamous cell carcinoma.
12525503 2003 MAGE-A4 interacts with the liver oncoprotein gankyrin and suppresses its tumorigenic activity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12209997 2002 Cancer-testis antigen expression in uterine malignancies with an emphasis on carcinosarcomas and papillary serous carcinomas.
12209610 2002 Prognostic relevance of MAGE-A4 tumor antigen expression in transitional cell carcinoma of the urinary bladder: a tissue microarray study.
11985796 2002 Elevation of serum MAGE-4 protein levels and prediction of hepatocellular carcinogenesis in patients with liver cirrhosis.
11502003 2001 High-resolution structure of HLA-A*0201 in complex with a tumour-specific antigenic peptide encoded by the MAGE-A4 gene.
9119398 1997 Alternative promoters of gene MAGE4a.
8575766 1995 The melanoma antigen gene (MAGE) family is clustered in the chromosomal band Xq28.
8037761 1994 Cloning and analysis of MAGE-1-related genes.
7927540 1994 Structure, chromosomal localization, and expression of 12 genes of the MAGE family.
7642112 1995 Sequence analysis of the MAGE gene family encoding human tumor-rejection antigens.
7591235 1995 Expression of MAGE genes in primary and metastatic cutaneous melanoma.