Property Summary

NCBI Gene PubMed Count 26
PubMed Score 18.87
PubTator Score 40.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 6.3e-17
malignant mesothelioma 3163 4.5e-10
non-small cell lung cancer 2798 2.3e-07
Disease Target Count Z-score Confidence
Melanoma 261 4.035 2.0

Synonym

Accession P43364 Q5ETU4 Q6ZRZ5
Symbols CT1.11
MAGE11
MAGE-11
MAGEA-11

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (15)

PMID Text
26330556 degradation of MAGE-A11 promoted by the human p14-ARF tumor suppressor contributes to low levels of MAGE-A11 in nontransformed cells
24316396 MAGE-A9 and MAGE-A11 are tumor-specific antigens and not only DNA hypermethylation but also histone deacetylation is responsible for the mechanism underlying MAGE-A9 and MAGE-A11 gene silencing.
23853093 MAGE-A11 is a proto-oncogene whose increased expression in prostate cancer reverses retinoblastoma-related protein p107 from a transcriptional repressor to a transcriptional activator of the androgen receptor and E2F1.
23839233 MAGEA11 regulation is highly instructive for understanding mechanisms regulating CG antigen genes in human cancer.
23172223 MAGE-A11 increases AR transcriptional activity by linking androgen receptor dimers.
23064813 MAGE-A11, similarly to HER-2 and ER-beta, may be an important diagnostic or prognostic indicator in breast cancer and potentially promotes tumor proliferation.
22334658 the functional defect associated with an AR exon 1 missense mutation.
21730049 Gain in transcriptional activity by primate-specific coevolution of melanoma antigen-A11 and its interaction site in androgen receptor.
20448036 MAGE-11 links NH(2)-terminal domains of AR and p300 to promote transcriptional synergy through a cadre of FXXLF-related interacting motifs
19828458 Results suggest that MAGE-11 functions as a bridging factor to recruit androgen receptor coactivators through a novel FXX(L/I)F motif-F-box interaction paradigm.
19372581 Increased expression of the AR coregulator MAGE-11 through promoter DNA hypomethylation and cyclic AMP is associated with prostate cancer
19147576 Knockdown of MAGE-11 by small interfering RNA results in decreased hypoxic induction of HIF-1alpha and its target genes. Inhibition of PHD by MAGE-11, and following activation of HIFs, is a novel tumor-associated HIF regulatory mechanism.
18212060 The time-dependent EGF-induced increase in AR transcriptional activity by MAGE-11 is mediated through AR activation functions 1 and 2 in association with the increased turnover of AR and MAGE-11.
18048459 The results suggest that MAGE-11 functions as a coregulator that increases AR transcriptional activity during the establishment of uterine receptivity in the human female.
15684378 MAGE-11 is a unique AR coregulator that increases AR activity by modulating the AR interdomain interaction.

AA Sequence

METQFRRGGLGCSPASIKRKKKREDSGDFGLQVSTMFSEDDFQSTERAPYGPQLQWSQDLPRVQVFREQA      1 - 70
NLEDRSPRRTQRITGGEQVLWGPITQIFPTVRPADLTRVIMPLEQRSQHCKPEEGLQAQEEDLGLVGAQA     71 - 140
LQAEEQEAAFFSSTLNVGTLEELPAAESPSPPQSPQEESFSPTAMDAIFGSLSDEGSGSQEKEGPSTSPD    141 - 210
LIDPESFSQDILHDKIIDLVHLLLRKYRVKGLITKAEMLGSVIKNYEDYFPEIFREASVCMQLLFGIDVK    211 - 280
EVDPTSHSYVLVTSLNLSYDGIQCNEQSMPKSGLLIIVLGVIFMEGNCIPEEVMWEVLSIMGVYAGREHF    281 - 350
LFGEPKRLLTQNWVQEKYLVYRQVPGTDPACYEFLWGPRAHAETSKMKVLEYIANANGRDPTSYPSLYED    351 - 420
ALREEGEGV                                                                 421 - 429
//

Text Mined References (26)

PMID Year Title
26330556 2015 Post-translational Down-regulation of Melanoma Antigen-A11 (MAGE-A11) by Human p14-ARF Tumor Suppressor.
25416956 2014 A proteome-scale map of the human interactome network.
24316396 2014 Expressions of MAGE-A9 and MAGE-A11 in breast cancer and their expression mechanism.
23853093 2013 Proto-oncogene activity of melanoma antigen-A11 (MAGE-A11) regulates retinoblastoma-related p107 and E2F1 proteins.
23839233 2013 DNA methylation and nucleosome occupancy regulate the cancer germline antigen gene MAGEA11.
23172223 2013 Melanoma antigen-A11 (MAGE-A11) enhances transcriptional activity by linking androgen receptor dimers.
23064813 2013 Expression of MAGE-A11 in breast cancer tissues and its effects on the proliferation of breast cancer cells.
22334658 2012 Androgen receptor exon 1 mutation causes androgen insensitivity by creating phosphorylation site and inhibiting melanoma antigen-A11 activation of NH2- and carboxyl-terminal interaction-dependent transactivation.
21730049 2011 Gain in transcriptional activity by primate-specific coevolution of melanoma antigen-A11 and its interaction site in androgen receptor.
20448036 2010 Transcriptional synergy between melanoma antigen gene protein-A11 (MAGE-11) and p300 in androgen receptor signaling.
19828458 2009 Melanoma antigen gene protein-A11 (MAGE-11) F-box links the androgen receptor NH2-terminal transactivation domain to p160 coactivators.
19372581 2009 Increased expression of androgen receptor coregulator MAGE-11 in prostate cancer by DNA hypomethylation and cyclic AMP.
19147576 2009 Melanoma antigen-11 inhibits the hypoxia-inducible factor prolyl hydroxylase 2 and activates hypoxic response.
18212060 2008 Epidermal-growth-factor-dependent phosphorylation and ubiquitinylation of MAGE-11 regulates its interaction with the androgen receptor.
18048459 2008 Hormone control and expression of androgen receptor coregulator MAGE-11 in human endometrium during the window of receptivity to embryo implantation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15684378 2005 Melanoma antigen gene protein MAGE-11 regulates androgen receptor function by modulating the interdomain interaction.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10521804 1999 Quantitative evaluation of the expression of MAGE genes in tumors by limiting dilution of cDNA libraries.
9495246 1998 MAGE-11 protein is highly conserved in higher organisms and located predominantly in the nucleus.
8575766 1995 The melanoma antigen gene (MAGE) family is clustered in the chromosomal band Xq28.
7927540 1994 Structure, chromosomal localization, and expression of 12 genes of the MAGE family.