Property Summary

NCBI Gene PubMed Count 16
PubMed Score 21.35
PubTator Score 28.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
Breast cancer 3578 2.0e-06
lung cancer 4740 4.3e-03
ovarian cancer 8520 4.7e-03
osteosarcoma 7950 2.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Cancer 2499 3.166 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer -1.100 2.0e-06
lung cancer 1.300 4.3e-03
osteosarcoma 1.051 2.8e-02
ovarian cancer -1.100 4.7e-03

Synonym

Accession P43363
Symbols CT1.10
MAGE10

Gene

PANTHER Protein Class (1)

  Ortholog (3)

Gene RIF (5)

AA Sequence

MPRAPKRQRCMPEEDLQSQSETQGLEGAQAPLAVEEDASSSTSTSSSFPSSFPSSSSSSSSSCYPLIPST      1 - 70
PEEVSADDETPNPPQSAQIACSSPSVVASLPLDQSDEGSSSQKEESPSTLQVLPDSESLPRSEIDEKVTD     71 - 140
LVQFLLFKYQMKEPITKAEILESVIRNYEDHFPLLFSEASECMLLVFGIDVKEVDPTGHSFVLVTSLGLT    141 - 210
YDGMLSDVQSMPKTGILILILSIVFIEGYCTPEEVIWEALNMMGLYDGMEHLIYGEPRKLLTQDWVQENY    211 - 280
LEYRQVPGSDPARYEFLWGPRAHAEIRKMSLLKFLAKVNGSDPRSFPLWYEEALKDEEERAQDRIATTDD    281 - 350
TTAMASASSSATGSFSYPE                                                       351 - 369
//

Text Mined References (17)

PMID Year Title