Property Summary

NCBI Gene PubMed Count 55
PubMed Score 186.90
PubTator Score 202.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
non-small cell lung cancer 2798 3.2e-07
malignant mesothelioma 3163 2.9e-06
lung cancer 4473 7.0e-05
Disease Target Count Z-score Confidence
Cancer 2346 5.049 2.5

Gene RIF (29)

PMID Text
25590999 TRIM31 directly binds to NSE4, suggesting the existence of a TRIM31-MAGEA1-NSE4 complex reminiscent of the NSE1-NSE3-NSE4 trimer.
25363021 Differential regulation of MAGE-A1 promoter activity by BORIS and Sp1, both interacting with the TATA binding protein.
23472218 DNA methylation has a dominant role in the epigenetic hierarchy governing MAGEA1 expression
22447174 results show the absence and/or low expression of MAGE A1 transcripts in oral squamous cell carcinoma; presence of hypomethylation at a small level at the promoter site of MAGE A1 was detected in both oral squamous cell carcinoma and normal oral mucosa
22134685 Report MAGEA1-A6 expression in sputum suggests presence of lung cancer cells or precancerous cells.
21273595 MAGE1 expression mediated by demethylation of MAGE1 promoter induce progression of non-small cell lung cancer.
21042944 High MAGE-1 is associated with differentiated advanced gastric cancer.
20862285 Observational study of gene-disease association. (HuGE Navigator)
20592351 MAGE-A peptides and HLA class I molecules are expressed in hepatocellular carcinoma
20423514 Tumor-specific antigen MAGE may play a role in the occurrence and development of ovarian cancerc and can be used as one of the important indicators for early diagnosis, efficacy evaluation and prognostic determination of ovarian cancer.
20420712 CCL3 and CCL20-recruited dendritic cells modified by melanoma antigen gene-1 have a role in anti-tumor immunity against gastric cancer
19467731 Since 37% of patients with operable NSCLC harbored disseminated tumor cells that expressed MAGE-A, only these patients might benefit from adjuvant immunotherapies directed against MAGE-A1 to -A6.
19259094 Treatment of A2780/cp70 with decitabine and belinostat results in a marked increase in expression of epigenetically silenced MLH1 and MAGE-A1 both in vitro and in vivo when compared with decitabine alone.
18820946 The protective effect of the expression of the MAGE-A1 gene against tumoral progression of neuroblastoma is confirmed.
18505125 The high expression rates of MAGE-1 and MAGE-3 genes in IHCC suggests the MAGE-1 and MAGE-3 gene may be a target for immunotherapy in IHCC patients.
18197853 Multiple simultaneous detection of MAGE-A [subtypes] more specific and sensitive than detection of single MAGE-A antigen for the diagnostic and prognostic evaluation of oral squamous cell carcinoma
18094622 demethylation of MAGE-A1 by Mouse embryonic stem cells
17704924 Report genetic alterations of MAGE A1 in Korean colorectal cancer patients.
17634428 These data show, for the first time, the involvement of methyl-CpG binding domain proteins in the regulation of the MAGE-A genes.
17611652 Results suggest that although MAGE-A1 does not participate directly in the drug-resistant phenotype, the expression of MAGE-A1 could be a marker for the prediction of resistance to taxan-based chemotherapies in patients with gastric cancers.
17208940 MAGE-A1 and NY-ESO-1 are associated with highly proliferating germ cells, whereas GAGE proteins have a more general function in germ cells unrelated to any specific developmental stage
17007017 The promoter hypomethylation of MAGE-A1 and MAGE-A3 genes up-regulates its expression in colorectal carcinomas as well as in gastric cancers and might play a significant role in the development and progression of human colorectal carcinomas.
16516880 Detection of aberrant methylation patterns of MAGEs CpG islands using Methylation-special PCR may be useful for diagnosis of Hepatocellular Carcinoma.
16497664 down-regulation of DNMT1 methyltransferase leads to activation and stable hypomethylation of MAGE-A1 in melanoma cells
16114059 Present, by immunocytochemistry, in normal prostate, prostatic hypertrophy and prostate cancer.
15353125 a novel sequence-specific DNA-protein interaction at the -30 CpG dinucleotide upstream of the gene was found having a vital part to play in the DNA methylation mediated transcription silencing of the MAGE-A1 gene
15316101 MAGE-A1 can function as a potent transcriptional repressor via interactions with Ski Interacting Protein and the deacetylase HDAC1.
14672620 Spontaneous in vivo priming of MAGE-specific T cell response and high frequency of MAGE1 and MAGE3 expression in hepatocellular carcinoma makes this antigen potential candidate for MAGE-specific immunotherapy in hepatocellular carcinoma.
12443884 The MAGE-A1 gene expression is not determined solely by methylation status of the promoter region in hematological malignancies.

AA Sequence

MSLEQRSLHCKPEEALEAQQEALGLVCVQAATSSSSPLVLGTLEEVPTAGSTDPPQSPQGASAFPTTINF      1 - 70
TRQRQPSEGSSSREEEGPSTSCILESLFRAVITKKVADLVGFLLLKYRAREPVTKAEMLESVIKNYKHCF     71 - 140
PEIFGKASESLQLVFGIDVKEADPTGHSYVLVTCLGLSYDGLLGDNQIMPKTGFLIIVLVMIAMEGGHAP    141 - 210
EEEIWEELSVMEVYDGREHSAYGEPRKLLTQDLVQEKYLEYRQVPDSDPARYEFLWGPRALAETSYVKVL    211 - 280
EYVIKVSARVRFFFPSLREAALREEEEGV                                             281 - 309
//

Text Mined References (62)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25590999 2015 The melanoma-associated antigen 1 (MAGEA1) protein stimulates the E3 ubiquitin-ligase activity of TRIM31 within a TRIM31-MAGEA1-NSE4 complex.
25416956 2014 A proteome-scale map of the human interactome network.
25363021 2014 Differential regulation of MAGE-A1 promoter activity by BORIS and Sp1, both interacting with the TATA binding protein.
23472218 2013 Epigenetic hierarchy within the MAGEA1 cancer-germline gene: promoter DNA methylation dictates local histone modifications.
22447174 2012 Evaluation of MAGE A1 in oral squamous cell carcinoma.
22134685 2012 MAGE A1-A6 RT-PCR and MAGE A3 and p16 methylation analysis in induced sputum from patients with lung cancer and non-malignant lung diseases.
21364888 2011 Interactions between the Nse3 and Nse4 components of the SMC5-6 complex identify evolutionarily conserved interactions between MAGE and EID Families.
21273595 2011 MAGE expressions mediated by demethylation of MAGE promoters induce progression of non-small cell lung cancer.
21269460 2011 Initial characterization of the human central proteome.
21042944 2011 Clinical significance of melanoma antigen-encoding gene-1 (MAGE-1) expression and its correlation with poor prognosis in differentiated advanced gastric cancer.
20862285 2010 Frequent MAGE mutations in human melanoma.
20592351 2010 Coexpression of MAGE-A peptides and HLA class I molecules in hepatocellular carcinoma.
20423514 2010 Expression of tumor-specific antigen MAGE, GAGE and BAGE in ovarian cancer tissues and cell lines.
20420712 2010 CCL3 and CCL20-recruited dendritic cells modified by melanoma antigen gene-1 induce anti-tumor immunity against gastric cancer ex vivo and in vivo.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19467731 2010 Expression of melanoma-antigen-A (MAGE-A) in disseminated tumor cells in regional lymph nodes of patients with operable non-small cell lung cancer.
19259094 2009 Combined inhibition of DNA methylation and histone acetylation enhances gene re-expression and drug sensitivity in vivo.
19177349 2009 Conformational changes within the HLA-A1:MAGE-A1 complex induced by binding of a recombinant antibody fragment with TCR-like specificity.
18820946 2009 MAGE-A1 expression is associated with good prognosis in neuroblastoma tumors.
18505125 2008 [Expression of melanoma antigen-1, 3 genes in human intrahepatic cholangiocarcinoma and its clinical significance].
18197853 2008 Expression of melanoma-associated antigens in oral squamous cell carcinoma.
18094622 Mouse embryonic stem cells induce targeted DNA demethylation within human MAGE-A1 transgenes.
17704924 2008 Genetic alterations of APC, K-ras, p53, MSI, and MAGE in Korean colorectal cancer patients.
17634428 2007 Methyl-CpG binding domain proteins and their involvement in the regulation of the MAGE-A1, MAGE-A2, MAGE-A3, and MAGE-A12 gene promoters.
17611652 2007 Melanoma-associated antigen-A1 expression predicts resistance to docetaxel and paclitaxel in advanced and recurrent gastric cancer.
17208940 2007 MAGE-A1, GAGE and NY-ESO-1 cancer/testis antigen expression during human gonadal development.
17007017 2006 Promoter hypomethylation and reactivation of MAGE-A1 and MAGE-A3 genes in colorectal cancer cell lines and cancer tissues.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16516880 2006 5' CpG island methylation analysis identifies the MAGE-A1 and MAGE-A3 genes as potential markers of HCC.
16497664 2006 Transient down-regulation of DNMT1 methyltransferase leads to activation and stable hypomethylation of MAGE-A1 in melanoma cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16114059 2006 Immunohistochemical expression of tumor antigens MAGE-A1, MAGE-A3/4, and NY-ESO-1 in cancerous and benign prostatic tissue.
15772651 2005 The DNA sequence of the human X chromosome.
15537658 2005 A major histocompatibility complex-peptide-restricted antibody and t cell receptor molecules recognize their target by distinct binding modes: crystal structure of human leukocyte antigen (HLA)-A1-MAGE-A1 in complex with FAB-HYB3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15353125 2004 A novel protein-DNA interaction involved with the CpG dinucleotide at -30 upstream is linked to the DNA methylation mediated transcription silencing of the MAGE-A1 gene.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15316101 2004 MAGE-A1 interacts with adaptor SKIP and the deacetylase HDAC1 to repress transcription.
15059299 2004 [The genetic polymorphism of melanoma-associated antigen 1 in Chinese normal donors and hepatoma patients].
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14672620 2004 Ex vivo characterization of tumor-derived melanoma antigen encoding gene-specific CD8+cells in patients with hepatocellular carcinoma.
12525503 2003 MAGE-A4 interacts with the liver oncoprotein gankyrin and suppresses its tumorigenic activity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12443884 2002 The MAGE-A1 gene expression is not determined solely by methylation status of the promoter region in hematological malignancies.
11776148 2000 Expression of the MAGE-1 gene in human hepatocellular carcinomas.
11691819 2001 Activation of melanoma antigen tumor antigens occurs early in lung carcinogenesis.
10854409 2000 Comparative genome sequence analysis of the Bpa/Str region in mouse and Man.
10363990 1999 Identification of a promiscuous T-cell epitope encoded by multiple members of the MAGE family.
8647853 1996 HLA photoaffinity labeling reveals overlapping binding of homologous melanoma-associated gene peptides by HLA-A1, HLA-A29, and HLA-B44.
8575766 1995 The melanoma antigen gene (MAGE) family is clustered in the chromosomal band Xq28.
8302824 1994 Identification of the MAGE-1 gene product by monoclonal and polyclonal antibodies.
8113684 1994 Human gene MAGE-3 codes for an antigen recognized on a melanoma by autologous cytolytic T lymphocytes.
8050815 1994 A member of the melanoma antigen-encoding gene (MAGE) family is expressed in human skin during wound healing.
8039421 1994 Localization of the MAGE1 gene encoding a human melanoma antigen to chromosome Xq28.
8037761 1994 Cloning and analysis of MAGE-1-related genes.
7927954 1994 MAGE-1 gene product is a cytoplasmic protein.
7927540 1994 Structure, chromosomal localization, and expression of 12 genes of the MAGE family.
7823968 1994 Identification of potential CTL epitopes of tumor-associated antigen MAGE-1 for five common HLA-A alleles.
7627949 1995 Identification of MAGE-1 and MAGE-4 proteins in spermatogonia and primary spermatocytes of testis.
1840703 1991 A gene encoding an antigen recognized by cytolytic T lymphocytes on a human melanoma.