Property Summary

NCBI Gene PubMed Count 20
PubMed Score 32.53
PubTator Score 16.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.500 3.9e-03
oligodendroglioma -1.400 1.2e-02
osteosarcoma -1.398 1.5e-02
group 4 medulloblastoma -2.600 3.0e-09
medulloblastoma, large-cell -2.100 1.4e-05
pancreatic ductal adenocarcinoma liver m... 1.347 1.7e-02
intraductal papillary-mucinous neoplasm ... 1.200 3.9e-03
aldosterone-producing adenoma -1.409 3.7e-02
gastric carcinoma 1.200 2.2e-02
ovarian cancer -2.500 5.2e-11

Protein-protein Interaction (1)

Gene RIF (5)

PMID Text
26214410 Results suggested that Wnt1-induced MAFK expression promoted cell proliferation in MG63 cells, and that the role of MAFK in osteosarcoma might be closely linked to the Wnt signaling pathway.
24247732 MafK mediated p65 acetylation by CBP upon LPS stimulation, thereby facilitating recruitment of p65 to NF-kappaB promoters such as IL-8 and TNFalpha.
24232097 Results suggest that JDP2 is an integral component of the Nrf2-MafK complex and that it modulates antioxidant and detoxification programs by acting via the ARE.
23737527 Data indicate that transcription factors MafK and Bach1 regulate expression of heme oxygenase-1 (HO-1).
22855609 These findings demonstrate that a combination of p45NF-E2, Maf G, and Maf K is a key determinant of both megakaryopoiesis and thrombopoiesis.

AA Sequence

MTTNPKPNKALKVKKEAGENAPVLSDDELVSMSVRELNQHLRGLTKEEVTRLKQRRRTLKNRGYAASCRI      1 - 70
KRVTQKEELERQRVELQQEVEKLARENSSMRLELDALRSKYEALQTFARTVARGPVAPSKVATTSVITIV     71 - 140
KSTELSSTSVPFSAAS                                                          141 - 156
//

Text Mined References (26)

PMID Year Title
26214410 2015 Wnt1-induced MAFK expression promotes osteosarcoma cell proliferation.
24247732 2013 MafK positively regulates NF-?B activity by enhancing CBP-mediated p65 acetylation.
24232097 2013 Jun dimerization protein 2 is a critical component of the Nrf2/MafK complex regulating the response to ROS homeostasis.
23737527 2013 Transforming growth factor-? induces transcription factors MafK and Bach1 to suppress expression of the heme oxygenase-1 gene.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22855609 2012 Induction of functional platelets from mouse and human fibroblasts by p45NF-E2/Maf.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12805554 2003 Comprehensive identification of human bZIP interactions with coiled-coil arrays.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11013233 2000 Small maf (MafG and MafK) proteins negatively regulate antioxidant response element-mediated expression and antioxidant induction of the NAD(P)H:Quinone oxidoreductase1 gene.
10747902 2000 Transcriptional regulation of the antioxidant response element. Activation by Nrf2 and repression by MafK.
10037736 1999 Molecular cloning and functional characterization of a new Cap'n' collar family transcription factor Nrf3.
9878398 1999 Macromolecular assemblage of aminoacyl-tRNA synthetases: identification of protein-protein interactions and characterization of a core protein.
9763667 1998 Structure and chromosome mapping of the human small maf-genes MAFG and MAFK.
9150357 1997 Human small Maf proteins form heterodimers with CNC family transcription factors and recognize the NF-E2 motif.
8887638 1996 Bach proteins belong to a novel family of BTB-basic leucine zipper transcription factors that interact with MafK and regulate transcription through the NF-E2 site.
8816476 1996 NF-E2 disrupts chromatin structure at human beta-globin locus control region hypersensitive site 2 in vitro.
8355703 1993 Purification of the human NF-E2 complex: cDNA cloning of the hematopoietic cell-specific subunit and evidence for an associated partner.