Property Summary

NCBI Gene PubMed Count 58
PubMed Score 92.32
PubTator Score 74.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Orofacial cleft 38 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0

Expression

  Differential Expression (26)

Gene RIF (39)

PMID Text
26554594 MAFB represents a unique signature and likely important regulator of the primate islet beta-cell.
26204962 The rs2902940A allele carriers in the MAFB conferred a decreased serum ApoAI level in controls and an increased risk of coronary artery disease and ischemic stroke.
26115698 MAFB is a regulator and a marker of adipose tissue inflammation, a process that subsequently causes insulin resistance
26055874 MiR-223 negatively regulates the growth and migration of NPC cells via reducing MAFB expression, and this finding provides a novel insight into understanding miR-223 regulation mechanism in nasopharyngeal carcinoma tumorigenesis.
25917456 Gata3 interacted with Gcm2 and MafB, two known transcriptional regulators of parathyroid development, and synergistically stimulated the PTH promoter.
25721756 DNMT3A R882 mutation is associated with elevated expression of MAFB and M4/M5 immunophenotype of acute myeloid leukemia blasts.
24989131 These findings indicate that only a few transactivation domain-specific mutations within MAFB cause multicentric carpotarsal osteolysis.
24972815 rs6065259 was the most important single nucleotide polymorphism in MAFB (OR6065259-AA=0.45; 95% CI: 0.28 to 0.71; p=0.0027), followed by rs13041247; no association was found between rs11696257 and NSCLP.
24472656 data support the existence of a signaling cascade by which stimulation of macrophages with the IL-10 cytokine determines a sequential activation of STAT3 and MafB transcription factors
24327562 Mafb is responsible for executing one branch of the SGN differentiation program orchestrated by the Gata3 transcriptional network
23956186 We identified MAFB mutations in all, including three novel missense mutations clustering within the hot spot mutation region
23863625 MAFA, MAFB, NKX6.1, and PDX1 activity provides a gauge of islet beta cell function, with loss of MAFA (and/or MAFB) representing an early indicator of beta cell inactivity
23225151 miR-148a directly targeted MAFB mRNA by binding to the 3' untranslated region (3'UTR) and repressed MAFB protein expression
22903061 the haematopoietic progenitor population can be the target for transformation in MafB-associated plasma cell neoplasias
22753311 MAFB gene suggest a role for the development of orofacial clefting in hispanic population.
22387013 Identified previously unreported missense mutations clustering within a 51 base pair region of the single exon of MAFB, validated by Sanger sequencing.
21839147 The homozygous kreisler mutation eliminates most of rhombomere 5 and mis-specifies rhombomere 6, abolishes an early decrease in respiratory frequency within 10 min of hypoxia and an intrinsic hypoxic activation.
21834038 findings confirmed the contribution of MAFB in the etiology of nonsyndromic orofacial clefts
21567910 An association of ABCA4 and MAFB with non-syndromic cleft lip with or without cleft palate.
21129249 Abnormal expression of maf-b correlates with abnormal proliferation of acute myeloid leukemia cells.
20969674 MafB expression was higher in smokers with airflow limitation than in smokers without airflow limitation.
20581830 MafB acts as a metastable switch to control expression of IFN-beta.
20506502 These results suggest a suppressive effect of HBZ on Maf function, which may have a significant role in HTLV-1 related pathogenesis.
20436469 Expression studies support a role for MAFB in palatal development.
20436469 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19395026 Both OH-2 and primary cells have a complex secondary translocation in which the IGK 3' enhancer is inserted between MYC and MAFB, resulting in dysregulation of both oncogenes
19332055 identified a Tfe3-binding site (EBox) in the MAFB promoter region
19060906 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19013005 Identification of primary MAFB target genes in multiple myeloma
18832725 the vitamin D(3)/Hox-A10 pathway supports MafB function during the induction of monocyte differentiation.
18830254 MafB may be a prognostic marker in the risk stratification of MM patients.
18615156 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16473681 Microarray analysis of Dupuytren's disease tissue has identified significant upregulated gene expression of MafB
16456583 MafB is a key regulator of monocytopoiesis
15598817 high PU.1 activity favors dendritic cells at the expense of macrophage fate by inhibiting expression and activity of the macrophage factor MafB.
15135046 Low-density lipoprotein receptor-related protein intracellular domain co-localizes with MafB to the nucleus and negatively regulates its transcriptional activity
15121870 novel role for MafB as a regulator of ERK-induced gene expression
12542796 Our data show that human monocytes, but not neutrophils, macrophages, dendritic or natural killer cells, downregulate the expression of Mac-1 after overnight exposure to surface-bound IgG.
12542795 strong proliferative signals mediated by T-cell activation and interleukins (IL-4 and IL-12) downregulate the mafB messenger RNA transcript level when resting naive CD4+ T-helper cells enter the differentiation pathway in vitro.

AA Sequence

MAAELSMGPELPTSPLAMEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQPAGSVSSTPLSTPCSSVPSS      1 - 70
PSFSPTEQKTHLEDLYWMASNYQQMNPEALNLTPEDAVEALIGSHPVPQPLQSFDSFRGAHHHHHHHHPH     71 - 140
PHHAYPGAGVAHDELGPHAHPHHHHHHQASPPPSSAASPAQQLPTSHPGPGPHATASATAAGGNGSVEDR    141 - 210
FSDDQLVSMSVRELNRHLRGFTKDEVIRLKQKRRTLKNRGYAQSCRYKRVQQKHHLENEKTQLIQQVEQL    211 - 280
KQEVSRLARERDAYKVKCEKLANSGFREAGSTSDSPSSPEFFL                               281 - 323
//

Text Mined References (61)

PMID Year Title
27181683 2016 Loss of MAFB Function in Humans and Mice Causes Duane Syndrome, Aberrant Extraocular Muscle Innervation, and Inner-Ear Defects.
26554594 2016 The MAFB transcription factor impacts islet ?-cell function in rodents and represents a unique signature of primate islet ?-cells.
26204962 2015 Association of polymorphisms in the MAFB gene and the risk of coronary artery disease and ischemic stroke: a case-control study.
26115698 2015 MAFB as a novel regulator of human adipose tissue inflammation.
26055874 2015 MiR-223 targeting MAFB suppresses proliferation and migration of nasopharyngeal carcinoma cells.
25917456 2015 Gata3 cooperates with Gcm2 and MafB to activate parathyroid hormone gene expression by interacting with SP1.
25721756 2015 DNMT3A R882 mutation is associated with elevated expression of MAFB and M4/M5 immunophenotype of acute myeloid leukemia blasts.
24989131 2014 Multicentric carpotarsal osteolysis syndrome is caused by only a few domain-specific mutations in MAFB, a negative regulator of RANKL-induced osteoclastogenesis.
24972815 2014 Association study of single nucleotide polymorphisms of MAFB with non-syndromic cleft lip with or without cleft palate in a population in Heilongjiang Province, northern China.
24472656 2014 MafB is a downstream target of the IL-10/STAT3 signaling pathway, involved in the regulation of macrophage de-activation.
24327562 2013 A Gata3-Mafb transcriptional network directs post-synaptic differentiation in synapses specialized for hearing.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23956186 2013 The identification of MAFB mutations in eight patients with multicentric carpo-tarsal osteolysis supports genetic homogeneity but clinical variability.
23863625 2013 Inactivation of specific ? cell transcription factors in type 2 diabetes.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23225151 2013 miR-148a regulates osteoclastogenesis by targeting V-maf musculoaponeurotic fibrosarcoma oncogene homolog B.
22903061 2012 A novel molecular mechanism involved in multiple myeloma development revealed by targeting MafB to haematopoietic progenitors.
22753311 2012 Association of candidate genes with nonsyndromic clefts in Honduran and Colombian populations.
22387013 2012 Multicentric carpotarsal osteolysis is caused by mutations clustering in the amino-terminal transcriptional activation domain of MAFB.
21839147 2011 The kreisler mutation leads to the loss of intrinsically hypoxia-activated spots in the region of the retrotrapezoid nucleus/parafacial respiratory group.
21834038 2011 Different roles of two novel susceptibility loci for nonsyndromic orofacial clefts in a Chinese Han population.
21732829 2011 Wnt signaling and Dupuytren's disease.
21567910 2011 Association of ABCA4 and MAFB with non-syndromic cleft lip with or without cleft palate.
21221126 2012 Genome-wide association study of serious blistering skin rash caused by drugs.
21129249 2010 [Expression of Maf-b mRNA in de novo leukemia patients and its clinical significance].
20969674 2011 Immunohistochemical staining for transcription factor MafB in alveolar macrophages is correlated with spirometric measures of airflow limitation in smokers.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20581830 2010 The transcription factor MafB antagonizes antiviral responses by blocking recruitment of coactivators to the transcription factor IRF3.
20506502 2010 HTLV-1 basic leucine-zipper factor, HBZ, interacts with MafB and suppresses transcription through a Maf recognition element.
20436469 2010 A genome-wide association study of cleft lip with and without cleft palate identifies risk variants near MAFB and ABCA4.
20102225 2010 Identification of bZIP interaction partners of viral proteins HBZ, MEQ, BZLF1, and K-bZIP using coiled-coil arrays.
19395026 2009 OH-2, a hyperdiploid myeloma cell line without an IGH translocation, has a complex translocation juxtaposing MYC near MAFB and the IGK locus.
19332055 2009 TFE3 transcription factor regulates the expression of MAFB during macrophage differentiation.
19143053 2008 A new MAFia in cancer.
19060906 2009 Common variants at 30 loci contribute to polygenic dyslipidemia.
19013005 2009 Identification of primary MAFB target genes in multiple myeloma.
18832725 2008 The vitamin D3/Hox-A10 pathway supports MafB function during the monocyte differentiation of human CD34+ hemopoietic progenitors.
18830254 2009 MafB oncoprotein detected by immunohistochemistry as a highly sensitive and specific marker for the prognostic unfavorable t(14;20) (q32;q12) in multiple myeloma patients.
18615156 Genome-wide association scan identifies candidate polymorphisms associated with differential response to anti-TNF treatment in rheumatoid arthritis.
18042454 2007 GSK-3-mediated phosphorylation enhances Maf-transforming activity.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16473681 2006 Expression of a novel gene, MafB, in Dupuytren's disease.
16456583 2006 Virally mediated MafB transduction induces the monocyte commitment of human CD34+ hematopoietic stem/progenitor cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15963504 2005 MafA transcription factor is phosphorylated by p38 MAP kinase.
15598817 2005 Balance of MafB and PU.1 specifies alternative macrophage or dendritic cell fate.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15135046 2004 Low-density lipoprotein receptor-related protein interacts with MafB, a regulator of hindbrain development.
15121870 2004 Extracellular signal-regulated kinase induces the megakaryocyte GPIIb/CD41 gene through MafB/Kreisler.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12798298 2003 c-jun regulation and function in the developing hindbrain.
12542796 2003 Downregulation of mac-1 expression in monocytes by surface-bound IgG.
12542795 2003 Downregulation of mafB expression in T-helper cells during early differentiation in vitro.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
10909854 2000 An autosomal dominant posterior polar cataract locus maps to human chromosome 20p12-q12.
10698492 2000 EAP1/Daxx interacts with ETS1 and represses transcriptional activation of ETS1 target genes.
10444328 1999 Human KRML (MAFB): cDNA cloning, genomic structure, and evaluation as a candidate tumor suppressor gene in myeloid leukemias.
8632993 1996 A yeast artificial chromosome-based map of the region of chromosome 20 containing the diabetes-susceptibility gene, MODY1, and a myeloid leukemia related gene.
8620536 1996 MafB is an interaction partner and repressor of Ets-1 that inhibits erythroid differentiation.
8001130 1994 The mouse segmentation gene kr encodes a novel basic domain-leucine zipper transcription factor.