Property Summary

Ligand Count 387
NCBI Gene PubMed Count 2,333
PubMed Score 9853.31
PubTator Score 9905.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Chronic obstructive pulmonary disease 184 0.0 1.1

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma -1.100 4.2e-03
atypical teratoid / rhabdoid tumor -1.300 3.8e-03
autosomal dominant Emery-Dreifuss muscul... 1.222 7.1e-03
Breast cancer 2.400 3.3e-02
dermatomyositis 1.200 2.3e-02
ependymoma 1.200 2.3e-02
group 3 medulloblastoma -1.900 6.1e-04
head and neck cancer and chronic obstruc... -1.200 1.4e-02
juvenile dermatomyositis 1.384 6.8e-10
lung carcinoma 1.100 2.4e-15
medulloblastoma, large-cell -1.400 6.6e-03
oligodendroglioma 1.500 5.6e-03
osteosarcoma 1.462 1.0e-06
ovarian cancer -1.100 4.9e-03
Pick disease -1.100 2.2e-04
Polycystic ovary syndrome 1.120 5.0e-03
psoriasis -1.300 1.0e-03
Rheumatoid arthritis 1.200 4.4e-02

Synonym

Accession P05067 B2R5V1 B4DII8 D3DSD1 D3DSD2 D3DSD3 P09000 P78438 Q13764 Q13778 Q13793 Q16011 Q16014 Q16019 Q16020 Q6GSC0 Q8WZ99 Q9BT38 Q9UC33 Q9UCA9 Q9UCB6 Q9UCC8 Q9UCD1 Q9UQ58
Symbols AAA
AD1
PN2
ABPP
APPI
CVAP
ABETA
PN-II
preA4
CTFgamma

Gene

APP

PANTHER Protein Class (2)

PDB (129)

Gene RIF (2063)

AA Sequence

MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGIL      1 - 70
QYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQER     71 - 140
MDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWW    141 - 210
GGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTT    211 - 280
ESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAMSQSLL    281 - 350
KTTQEPLARDPVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQA    351 - 420
KNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHV    421 - 490
FNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQD    491 - 560
EVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVP    561 - 630
ANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKG    631 - 700
AIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN    701 - 770
//

Text Mined References (2347)

PMID Year Title