Property Summary

NCBI Gene PubMed Count 30
PubMed Score 22.51
PubTator Score 78.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0
Disease Target Count Z-score Confidence
diabetes mellitus 1663 3.5 1.8
Hyperglycemia 120 3.039 1.5

Expression

Gene RIF (26)

PMID Text
26546820 These findings demonstrate that regulation of monoamine levels by Mao activity in beta cells is pivotal for physiological insulin secretion and that loss of MaoB expression may contribute to the beta cell dysfunction in type 2 diabetes.
24157940 Loss of MAFA expression is associated with insulinoma.
24013263 MAFA nuclear expression in pancreatic alpha and beta cells, and the percentage of alpha cells expressing PAX4 are altered in patients with type 2 diabetes.
23863625 MAFA, MAFB, NKX6.1, and PDX1 activity provides a gauge of islet beta cell function, with loss of MAFA (and/or MAFB) representing an early indicator of beta cell inactivity
23660596 under oxidative and nonoxidative conditions p38 MAPK directly binds to MafA and triggers MafA degradation via ubiquitin proteasomal pathway.
22847061 Beta cell nuclear MafA is markedly decreased in humans with type 2 diabetes, which may contribute to impaired beta cell dysfunction.
22761608 Combined transfection of the three transcriptional factors, PDX-1, NeuroD1, and MafA, causes differentiation of bone marrow mesenchymal stem cells into insulin-producing cells
21278484 MafA transcription is upregulated in beta-cells acutely cultured in high glucose similar to what may occur in vivo under normoglycemic conditions.
21278380 ATF2 interacts with beta-cell-enriched transcription factors, MafA, Pdx1, and beta2, and activates insulin gene transcription.
20213756 In addition to its expression in pancreatic beta cells, MafA also identifies the early ret-expressing sensory neurons in the dorsal root ganglia.
20208071 a novel relationship between the phosphoamino acid-rich transactivation and b-Zip domains in controlling MafA DNA-binding activity.
20158571 Data suggest that MafA plays a novel role in the reprogramming of stem cells into pancreatic beta-progenitors, promotes the islet-like characteristics of PDMSCs, as well as functionally regulation of blood glucose levels in transplanted grafts.
19573128 gene is unlikely to have a significant role in monogenic diabetes in humans
19407223 p38 MAPK is a major regulator of MafA protein stability under oxidative stress
19393272 MafA plays a crucial role in pancreatic beta-cells and could be a novel therapeutic target for diabetes
18948074 MafA levels are tightly controlled by the coordinated action of multiple kinase pathways
18753309 Data suggest that a group of transcription factors, including MafA and Foxa2, regulate expression of two major autoantigens in type 1 diabetes, including islet-specific glucose-6-phosphatase catalytic subunit-related protein.
18522939 Significance of large Maf proteins to Pdx1 expression in beta cells, and in particular MafB during pancreatic development.
18508668 Under diabetic conditions, expression and/or activities of PDX-1 and MafA in beta-cells are reduced [REVIEW].
18042454 Transcriptional and transforming activities of MafA are positively regulated by GSK-3-mediated phosphorylation.
17636040 MafA has a critical role in islet beta-cell function
16847327 Data show that FoxA2, Nkx2.2, and PDX-1 regulate islet beta-cell-specific mafA expression through conserved sequences located between base pairs -8118 and -7750 upstream from the transcription start site.
15993959 Co-expression and functional synergism of these beta-cell enriched transactivators, MafA, Pdx1, and Beta2, are critical for establishing the beta-cell-specific and efficient expression of the insulin gene.
15665000 MafA plays a key role in coordinating and controlling the level of insulin gene expression in islet beta cells.
15664997 mafA has a role in regulating insulin gene expression in the liver
14973194 MafA selectively induces endogenous insulin transcription in non-beta cells

AA Sequence

MAAELAMGAELPSSPLAIEYVNDFDLMKFEVKKEPPEAERFCHRLPPGSLSSTPLSTPCSSVPSSPSFCA      1 - 70
PSPGTGGGGGAGGGGGSSQAGGAPGPPSGGPGAVGGTSGKPALEDLYWMSGYQHHLNPEALNLTPEDAVE     71 - 140
ALIGSGHHGAHHGAHHPAAAAAYEAFRGPGFAGGGGADDMGAGHHHGAHHAAHHHHAAHHHHHHHHHHGG    141 - 210
AGHGGGAGHHVRLEERFSDDQLVSMSVRELNRQLRGFSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRH    211 - 280
ILESEKCQLQSQVEQLKLEVGRLAKERDLYKEKYEKLAGRGGPGSAGGAGFPREPSPPQAGPGGAKGTAD    281 - 350
FFL                                                                       351 - 353
//

Text Mined References (34)

PMID Year Title
26546820 2015 Islet-specific monoamine oxidase A and B expression depends on MafA transcriptional activity and is compromised in type 2 diabetes.
24157940 2013 Altered MENIN expression disrupts the MAFA differentiation pathway in insulinoma.
24013263 2013 Both PAX4 and MAFA are expressed in a substantial proportion of normal human pancreatic alpha cells and deregulated in patients with type 2 diabetes.
23863625 2013 Inactivation of specific ? cell transcription factors in type 2 diabetes.
23660596 2013 Preventing p38 MAPK-mediated MafA degradation ameliorates ?-cell dysfunction under oxidative stress.
23148532 2012 A novel DNA binding mechanism for maf basic region-leucine zipper factors inferred from a MafA-DNA complex structure and binding specificities.
22847061 2012 Beta cell nuclear musculoaponeurotic fibrosarcoma oncogene family A (MafA) is deficient in type 2 diabetes.
22761608 2012 Combined transfection of the three transcriptional factors, PDX-1, NeuroD1, and MafA, causes differentiation of bone marrow mesenchymal stem cells into insulin-producing cells.
21278484 Regulation of ?-cell-specific and glucose-dependent MafA expression.
21278380 2011 ATF2 interacts with beta-cell-enriched transcription factors, MafA, Pdx1, and beta2, and activates insulin gene transcription.
20213756 2010 MafA transcription factor identifies the early ret-expressing sensory neurons.
20208071 2010 Phosphorylation within the MafA N terminus regulates C-terminal dimerization and DNA binding.
20158571 2011 MafA promotes the reprogramming of placenta-derived multipotent stem cells into pancreatic islets-like and insulin+ cells.
19573128 2009 Mutations in MAFA and IAPP are not a common cause of monogenic diabetes.
19407223 2009 p38 MAPK is a major regulator of MafA protein stability under oxidative stress.
19393272 2009 Role of MafA in pancreatic beta-cells.
19143053 2008 A new MAFia in cancer.
18948074 2008 Multiple kinases regulate mafA expression in the pancreatic beta cell line MIN6.
18753309 2008 Foxa2 and MafA regulate islet-specific glucose-6-phosphatase catalytic subunit-related protein gene expression.
18522939 2008 MafA and MafB regulate Pdx1 transcription through the Area II control region in pancreatic beta cells.
18508668 2008 PDX-1 functions as a master factor in the pancreas.
18042454 2007 GSK-3-mediated phosphorylation enhances Maf-transforming activity.
17941991 2007 Induction of insulin secretion in engineered liver cells by nitric oxide.
17636040 2007 MafA regulates expression of genes important to islet beta-cell function.
16847327 2006 FoxA2, Nkx2.2, and PDX-1 regulate islet beta-cell-specific mafA expression through conserved sequences located between base pairs -8118 and -7750 upstream from the transcription start site.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15993959 2005 Synergistic activation of the insulin gene promoter by the beta-cell enriched transcription factors MafA, Beta2, and Pdx1.
15963504 2005 MafA transcription factor is phosphorylated by p38 MAP kinase.
15665000 2005 The islet beta cell-enriched MafA activator is a key regulator of insulin gene transcription.
15664997 2005 A crucial role of MafA as a novel therapeutic target for diabetes.
14973194 2004 The MafA transcription factor appears to be responsible for tissue-specific expression of insulin.
12368292 2002 MafA is a glucose-regulated and pancreatic beta-cell-specific transcriptional activator for the insulin gene.
12011435 2002 Identification of beta-cell-specific insulin gene transcription factor RIPE3b1 as mammalian MafA.
11416124 2001 Phosphorylation of MafA is essential for its transcriptional and biological properties.