Property Summary

NCBI Gene PubMed Count 27
PubMed Score 66.49
PubTator Score 33.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8297 1.0e-05
Disease Target Count Z-score Confidence
Cataract 7 32 3.748 1.9

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.700 1.0e-05

Protein-protein Interaction (8)

Gene RIF (18)

AA Sequence

MKLLENSSFEAINSQLTVETGDAHIIGRIESYSCKMAGDDKHMFKQFCQEGQPHVLEALSPPQTSGLSPS      1 - 70
RLSKSQGGEEEGPLSDKCSRKTLFYLIATLNESFRPDYDFSTARSHEFSREPSLSWVVNAVNCSLFSAVR     71 - 140
EDFKDLKPQLWNAVDEEICLAECDIYSYNPDLDSDPFGEDGSLWSFNYFFYNKRLKRIVFFSCRSISGST    141 - 210
YTPSEAGNELDMELGEEEVEEESRSGGSGAEETSTMEEDRVPVICI                            211 - 256
//

Text Mined References (35)

PMID Year Title