Property Summary

NCBI Gene PubMed Count 14
PubMed Score 28.05
PubTator Score 10.26

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.700 5.5e-03
oligodendroglioma -1.600 7.2e-03
group 3 medulloblastoma -2.400 1.2e-04
glioblastoma -1.300 7.7e-03
medulloblastoma, large-cell -2.300 1.7e-04
primitive neuroectodermal tumor -1.800 1.9e-03

Gene RIF (6)

PMID Text
24189637 Immunofluorescence analysis showed that MAEL co-localizes with the stress granule marker PABPC1 in stress granules during oxidative stress. MAEL may be involved in miRNA-mediated gene silencing in SGs.
23929794 Maelstrom promotes hepatocellular carcinoma metastasis by inducing epithelial-mesenchymal transition by way of Akt/GSK-3beta/Snail signaling.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19693694 These results suggest that MAEL is a novel cancer/testis-associated gene and is regulated by DNA methylation.
19536175 Observational study of gene-disease association. (HuGE Navigator)
19064610 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPNRKASRNAYYFFVQEKIPELRRRGLPVARVADAIPYCSSDWALLREEEKEKYAEMAREWRAAQGKDPG      1 - 70
PSEKQKPVFTPLRRPGMLVPKQNVSPPDMSALSLKGDQALLGGIFYFLNIFSHGELPPHCEQRFLPCEIG     71 - 140
CVKYSLQEGIMADFHSFINPGEIPRGFRFHCQAASDSSHKIPISNFERGHNQATVLQNLYRFIHPNPGNW    141 - 210
PPIYCKSDDRTRVNWCLKHMAKASEIRQDLQLLTVEDLVVGIYQQKFLKEPSKTWIRSLLDVAMWDYSSN    211 - 280
TRCKWHEENDILFCALAVCKKIAYCISNSLATLFGIQLTEAHVPLQDYEASNSVTPKMVVLDAGRYQKLR    281 - 350
VGSSGFSHFNSSNEEQRSNTPIGDYPSRAKISGQNSSVRGRGITRLLESISNSSSNIHKFSNCDTSLSPY    351 - 420
MSQKDGYKSFSSLS                                                            421 - 434
//

Text Mined References (15)

PMID Year Title
25367360 2015 Genome-wide association study for refractive astigmatism reveals genetic co-determination with spherical equivalent refractive error: the CREAM consortium.
24189637 2014 Proteomic analysis reveals that MAEL, a component of nuage, interacts with stress granule proteins in cancer cells.
23929794 2014 Maelstrom promotes hepatocellular carcinoma metastasis by inducing epithelial-mesenchymal transition by way of Akt/GSK-3?/Snail signaling.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19693694 2010 Identification of a novel human cancer/testis gene MAEL that is regulated by DNA methylation.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
19064610 2009 Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible genetic association with bone mineral density variation.
18694567 2008 Mouse maelstrom, a component of nuage, is essential for spermatogenesis and transposon repression in meiosis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.