Property Summary

NCBI Gene PubMed Count 51
PubMed Score 70.60
PubTator Score 72.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
posterior fossa group A ependymoma -1.600 6.3e-16
glioblastoma -1.400 5.5e-06
atypical teratoid/rhabdoid tumor -1.600 2.1e-10
adult high grade glioma -1.600 1.1e-06
pilocytic astrocytoma -1.200 2.5e-08
sonic hedgehog group medulloblastoma -1.100 1.2e-05
subependymal giant cell astrocytoma -1.222 3.5e-02
lung carcinoma 1.200 2.7e-29

Protein-protein Interaction (1)

Gene RIF (31)

PMID Text
26517243 miR-3151 silencing by DNA methylation protected chronic lymphocytic leukemia cells from apoptosis by over-expression of its direct targets MADD and PIK3R2, constitutive activation of MEK/ERK and PI3K/AKT signaling , and over-expression of MCL1.
24038283 Taken together, our data reveal that PTEN can convey the death signal by preventing MADD phosphorylation by Akt.
23457619 MADD knockdown resulted in enhanced spontaneous apoptosis in human breast cancer cell lines
23443411 These results suggest that MADD may be a potential therapeutic target for lung adenocarcinoma therapy involving the TRAIL-induced apoptosis pathway
22678883 We analyzed DENN/MADD/IG20 (DMI), the complex of four splice variants in Alzheimer's disease.
22529996 SNP rs2290149, located in a genetic cluster of MYBPC3 and MADD gene, was found to be associated with diastolic heart failure.
22482404 Data show that ehe expression of MAPK-activating death domain protein (MADD) increases obviously in lung adenocarcinoma, and MADD can promote survival of lung adenocarcinoma cells by inhibiting apoptosis.
21887289 The SNP in ADCY5 is implicated in defective proinsulin-to-insulin conversion and previous findings on the role of a genetic variant in MADD on proinsulin-to-insulin conversion, were confirmed.
21103350 Data show that SNPs from MADD, PROX1, and SLC30A8 were associated with type 2 diabetes.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20484047 Endogenous MADD is phosphorylated at three highly conserved sites by Akt, and only the phosphorylated MADD can directly interact with the TRAIL receptor DR4 thereby preventing Fas-associated death domain recruitment.
20419449 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20185807 Observational study of gene-disease association. (HuGE Navigator)
20081858 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19289468 Loss of MADD expression resulted in reduced Grb2 and Sos1/2 recruitment to the TNFR1 complex and decreased Ras and MEKK1/2 activation
19060911 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18849981 KIF1Bbeta- and KIF1A-mediated axonal transport of presynaptic regulator Rab3 occurs in a GTP-dependent manner through MADD.
18794122 Expression of KIAA0358 exerted a potent antiapoptotic effect in both the SK-N-SH and SH-SY5Y neuroblastoma cell lines, whereas expression of IG20-SV4 had proapoptotic effects directly related to the activation of caspase-8 in these cells.
18223207 we have identified an essential role for splice variants of the IG20 gene in TRAIL (tumor necrosis factor-related apoptosis-inducing ligand)resistance.
17410194 data strongly indicate that germline mutations in SPI1 and MADD genes do not confer a high risk of chronic lymphocytic leukaemia and do not make a major contribution to the familial risk of the disease
17314102 MADD has a role in the control of cancer cell survival/death as a negative regulator of caspase-8 and confers significant resistance to TRAIL-induced apoptosis
16682944 Knockdown of MADD can render cells susceptible to spontaneous apoptosis but had no discernible effect on cell proliferation, colony size or cell cycle progression. MADD alone is sufficient and necessary for cancer cell survival.
15208670 IG20 (MADD splice variant-5) enhances TRAIL-induced apoptosis by increasing recruitment of FADD and caspase-8 to the death-inducing signaling complex.
15103018 The mRNA expression levels for alpha-tubulin, TRADD, IFN-gamma R2, GAS1, MADD, NF-kappaB, I-kappa B, 14-3-3 protein, APaf1, PARP, IGF-1 receptor, RB1, Rb2/p130, ARC, and caspase 6 are upregulated in human neuronal cells after treatment with HIV-1 gp120
14735464 DENN has anti-apoptotic and cell survival roles in tumor cells
14716293 IG20 suppresses tumor cell survival and enhances susceptibility to apoptosis and cancer therapy.
14695193 IG20 overexpression enhanced the combined apoptotic effects of TRAIL and gamma-irradiation on HeLa cells.
12410563 Denn is intimately involved in anti-apoptotic and cell survival processes in cancer cells

AA Sequence

MVQKKKFCPRLLDYLVIVGARHPSSDSVAQTPELLRRYPLEDHTEFPLPPDVVFFCQPEGCLSVRQRRMS      1 - 70
LRDDTSFVFTLTDKDTGVTRYGICVNFYRSFQKRISKEKGEGGAGSRGKEGTHATCASEEGGTESSESGS     71 - 140
SLQPLSADSTPDVNQSPRGKRRAKAGSRSRNSTLTSLCVLSHYPFFSTFRECLYTLKRLVDCCSERLLGK    141 - 210
KLGIPRGVQRDTMWRIFTGSLLVEEKSSALLHDLREIEAWIYRLLRSPVPVSGQKRVDIEVLPQELQPAL    211 - 280
TFALPDPSRFTLVDFPLHLPLELLGVDACLQVLTCILLEHKVVLQSRDYNALSMSVMAFVAMIYPLEYMF    281 - 350
PVIPLLPTCMASAEQLLLAPTPYIIGVPASFFLYKLDFKMPDDVWLVDLDSNRVIAPTNAEVLPILPEPE    351 - 420
SLELKKHLKQALASMSLNTQPILNLEKFHEGQEIPLLLGRPSNDLQSTPSTEFNPLIYGNDVDSVDVATR    421 - 490
VAMVRFFNSANVLQGFQMHTRTLRLFPRPVVAFQAGSFLASRPRQTPFAEKLARTQAVEYFGEWILNPTN    491 - 560
YAFQRIHNNMFDPALIGDKPKWYAHQLQPIHYRVYDSNSQLAEALSVPPERDSDSEPTDDSGSDSMDYDD    561 - 630
SSSSYSSLGDFVSEMMKCDINGDTPNVDPLTHAALGDASEVEIDELQNQKEAEEPGPDSENSQENPPLRS    631 - 700
SSSTTASSSPSTVIHGANSEPADSTEMDDKAAVGVSKPLPSVPPSIGKSNVDRRQAEIGEGSVRRRIYDN    701 - 770
PYFEPQYGFPPEEDEDEQGESYTPRFSQHVSGNRAQKLLRPNSLRLASDSDAESDSRASSPNSTVSNTST    771 - 840
EGFGGIMSFASSLYRNHSTSFSLSNLTLPTKGAREKATPFPSLKVFGLNTLMEIVTEAGPGSGEGNRRAL    841 - 910
VDQKSSVIKHSPTVKREPPSPQGRSSNSSENQQFLKEVVHSVLDGQGVGWLNMKKVRRLLESEQLRVFVL    911 - 980
SKLNRMVQSEDDARQDIIPDVEISRKVYKGMLDLLKCTVLSLEQSYAHAGLGGMASIFGLLEIAQTHYYS    981 - 1050
KEPDKRKRSPTESVNTPVGKDPGLAGRGDPKAMAQLRVPQLGPRAPSATGKGPKELDTRSLKEENFIASI   1051 - 1120
ELWNKHQEVKKQKALEKQRPEVIKPVFDLGETEEKKSQISADSGVSLTSSSQRTDQDSVIGVSPAVMIRS   1121 - 1190
SSQDSEVSTVVSNSSGETLGADSDLSSNAGDGPGGEGSVHLASSRGTLSDSEIETNSATSTIFGKAHSLK   1191 - 1260
PSIKEKLAGSPIRTSEDVSQRVYLYEGLLGRDKGSMWDQLEDAAMETFSISKERSTLWDQMQFWEDAFLD   1261 - 1330
AVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLLHNLISYMLLMKVNKNDIRKKVRRLM   1331 - 1400
GKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSN   1401 - 1470
IGTVYERWWYEKLINMTYCPKTKVLCLWRRNGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGP   1471 - 1540
ELGGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQVFIELNHIKKCNTVRGVFVLEEFVPEIKEVVSHKYK   1541 - 1610
TPMAHEICYSVLCLFSYVAAVHSSEEDLRTPPRPVSS                                    1611 - 1647
//

Text Mined References (59)

PMID Year Title
26517243 2015 Epigenetic silencing of tumor suppressor miR-3151 contributes to Chinese chronic lymphocytic leukemia by constitutive activation of MADD/ERK and PIK3R2/AKT signaling pathways.
24038283 2014 MADD is a downstream target of PTEN in triggering apoptosis.
23457619 2013 MADD knock-down enhances doxorubicin and TRAIL induced apoptosis in breast cancer cells.
23443411 2013 MADD promotes the survival of human lung adenocarcinoma cells by inhibiting apoptosis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22678883 2012 DENN/MADD/IG20 alternative splicing changes and cell death in Alzheimer's disease.
22581228 2012 A genome-wide approach accounting for body mass index identifies genetic variants influencing fasting glycemic traits and insulin resistance.
22529996 2012 Cardiac myosin binding protein C and MAP-kinase activating death domain-containing gene polymorphisms and diastolic heart failure.
22482404 2012 [Expression of MADD in lung adenocarcinoma tissues and its effects on proliferation and apoptosis of lung adenocarcinoma A549 cells].
21887289 2011 Glucose-raising genetic variants in MADD and ADCY5 impair conversion of proinsulin to insulin.
21873549 2011 Genome-wide association identifies nine common variants associated with fasting proinsulin levels and provides new insights into the pathophysiology of type 2 diabetes.
21269460 2011 Initial characterization of the human central proteome.
21103350 2010 Variants from GIPR, TCF7L2, DGKB, MADD, CRY2, GLIS3, PROX1, SLC30A8 and IGF1 are associated with glucose metabolism in the Chinese.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20937701 2010 Family-wide characterization of the DENN domain Rab GDP-GTP exchange factors.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20571754 2010 Evaluating the discriminative power of multi-trait genetic risk scores for type 2 diabetes in a northern Swedish population.
20484047 2010 Akt-phosphorylated mitogen-activated kinase-activating death domain protein (MADD) inhibits TRAIL-induced apoptosis by blocking Fas-associated death domain (FADD) association with death receptor 4.
20419449 2010 Variants at DGKB/TMEM195, ADRA2A, GLIS3 and C2CD4B loci are associated with reduced glucose-stimulated beta cell function in middle-aged Danish people.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20185807 2010 Detailed physiologic characterization reveals diverse mechanisms for novel genetic Loci regulating glucose and insulin metabolism in humans.
20081858 2010 New genetic loci implicated in fasting glucose homeostasis and their impact on type 2 diabetes risk.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19289468 2009 MADD, a splice variant of IG20, is indispensable for MAPK activation and protection against apoptosis upon tumor necrosis factor-alpha treatment.
19060911 2009 Loci influencing lipid levels and coronary heart disease risk in 16 European population cohorts.
18849981 2008 KIF1Bbeta- and KIF1A-mediated axonal transport of presynaptic regulator Rab3 occurs in a GTP-dependent manner through DENN/MADD.
18794122 2008 Regulation of apoptosis and caspase-8 expression in neuroblastoma cells by isoforms of the IG20 gene.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18223207 2008 Role of IG20 splice variants in TRAIL resistance.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17410194 2007 Germline mutations in SPI1 and MADD do not contribute to familial chronic lymphocytic leukaemia.
17314102 2007 MADD/DENN splice variant of the IG20 gene is a negative regulator of caspase-8 activation. Knockdown enhances TRAIL-induced apoptosis of cancer cells.
16682944 2006 MADD/DENN splice variant of the IG20 gene is necessary and sufficient for cancer cell survival.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16273344 2005 The IA-2 interactome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15208670 2004 IG20 (MADD splice variant-5), a proapoptotic protein, interacts with DR4/DR5 and enhances TRAIL-induced apoptosis by increasing recruitment of FADD and caspase-8 to the DISC.
15007167 2004 Down-regulation of DENN/MADD, a TNF receptor binding protein, correlates with neuronal cell death in Alzheimer's disease brain and hippocampal neurons.
14735464 2004 Antisense abrogation of DENN expression induces apoptosis of leukemia cells in vitro, causes tumor regression in vivo and alters the transcription of genes involved in apoptosis and the cell cycle.
14716293 2004 IG20, in contrast to DENN-SV, (MADD splice variants) suppresses tumor cell survival, and enhances their susceptibility to apoptosis and cancer drugs.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14695193 2003 IG20, a MADD splice variant, increases cell susceptibility to gamma-irradiation and induces soluble mediators that suppress tumor cell growth.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421765 2002 Protein-protein interactions between large proteins: two-hybrid screening using a functionally classified library composed of long cDNAs.
12410563 2002 Induction of marked apoptosis in mammalian cancer cell lines by antisense DNA treatment to abolish expression of DENN (differentially expressed in normal and neoplastic cells).
11577081 2001 Contrasting effects of IG20 and its splice isoforms, MADD and DENN-SV, on tumor necrosis factor alpha-induced apoptosis and activation of caspase-8 and -3.
10970871 2000 The Rab3 GDP/GTP exchange factor homolog AEX-3 has a dual function in synaptic transmission.
10825539 2000 LRDD, a novel leucine rich repeat and death domain containing protein.
10756096 2000 Statistical analysis of the 5' untranslated region of human mRNA using "Oligo-Capped" cDNA libraries.
9796103 1998 The human DENN gene: genomic organization, alternative splicing, and localization to chromosome 11p11.21-p11.22.
9482930 1998 A splicing variant of a death domain protein that is regulated by a mitogen-activated kinase is a substrate for c-Jun N-terminal kinase in the human central nervous system.
9205841 1997 Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
9115275 1997 MADD, a novel death domain protein that interacts with the type 1 tumor necrosis factor receptor and activates mitogen-activated protein kinase.
8988362 1996 DENN, a novel human gene differentially expressed in normal and neoplastic cells.