Property Summary

NCBI Gene PubMed Count 31
PubMed Score 252.29
PubTator Score 92.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Colitis 52 0.0 0.0
Ovarian Cysts 40 0.0 0.0
Disease Target Count P-value
group 3 medulloblastoma 4002 6.6e-04
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.6
Disease Target Count Z-score Confidence
Type 1 diabetes mellitus 106 0.0 3.0

Expression

  Differential Expression (1)

Disease log2 FC p
group 3 medulloblastoma -1.200 6.6e-04

Protein-protein Interaction (3)

Gene RIF (16)

AA Sequence

MDFGLALLLAGLLGLLLGQSLQVKPLQVEPPEPVVAVALGASRQLTCRLACADRGASVQWRGLDTSLGAV      1 - 70
QSDTGRSVLTVRNASLSAAGTRVCVGSCGGRTFQHTVQLLVYAFPDQLTVSPAALVPGDPEVACTAHKVT     71 - 140
PVDPNALSFSLLVGGQELEGAQALGPEVQEEEEEPQGDEDVLFRVTERWRLPPLGTPVPPALYCQATMRL    141 - 210
PGLELSHRQAIPVLHSPTSPEPPDTTSPESPDTTSPESPDTTSQEPPDTTSPEPPDKTSPEPAPQQGSTH    211 - 280
TPRSPGSTRTRRPEISQAGPTQGEVIPTGSSKPAGDQLPAALWTSSAVLGLLLLALPTYHLWKRCRHLAE    281 - 350
DDTHPPASLRLLPQVSAWAGLRGTGQVGISPS                                          351 - 382
//

Text Mined References (33)

PMID Year Title