Property Summary

NCBI Gene PubMed Count 31
PubMed Score 0.91
PubTator Score 80.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.400 2.4e-04
non primary Sjogren syndrome sicca 1.100 1.6e-02
acute myeloid leukemia 1.300 4.8e-03
ovarian cancer 1.100 6.8e-05

Gene RIF (17)

PMID Text
26544187 p31comet-induced cell death is mediated by interactions with Mad2
26324890 the oligomeric form of TRIP13 binds both p31(comet) and MCC
25092294 joint action of TRIP13 and p31(comet) also promotes the release of Mad2 from MCC, participates in the complete disassembly of MCC and abrogates checkpoint inhibition of APC/C
24596092 attenuating the affinity of p31(Comet) for Mad2 by phosphorylation promotes SAC activity in mitosis. Specifically, phosphorylation of Ser-102 weakens p31(Comet)-Mad2 binding and enhances p31(Comet)-mediated bypass of the SAC.
24131926 Altered p31(Comet):Mad2 expression ratios may provide new insight into altered spindle assembly checkpoint function and the generation of chromosomal instability in tumors.
22566641 The binding of p31(comet) to Mad2 in mitotic checkpoint complex may trigger a conformational change in Cdc20 that facilitates its phosphorylation by Cdk, and that the latter process may promote its dissociation from BubR1.
22544748 the importance of p31(comet) in checkpoint silencing and its potential as a target for antimitotic therapies.
22235654 This review presents knowledge of CMT2 and possible pathogenetic mechanisms responsible for the disease
22100920 p31(comet) negatively regulates the spindle assembly checkpoint by extracting Mad2 from the MCC.
21965286 study found p31(comet) traffics on and off kinetochores and also present in the cytosol; Cells depleted of p31(comet) arrest in metaphase with mature bipolar kinetochore-microtubule attachments; propose that p31(comet) is an essential component of machinery that silences the checkpoint during each cell cycle
21937719 both p31(comet) and ubiquitination of Cdc20 are critical mechanisms of checkpoint inactivation. They act redundantly to promote Mad2 dissociation from Cdc20
21772247 p31comet localizes to kinetochores in a C-Mad2-dependent manner. the Mad1:C-Mad2 complex undergoes regulation by p31comet-dependent 'capping'.
21300909 Although p31(comet) binds to Mad2, it promotes the dissociation of Cdc20 from BubR1 in MCC.
19276188 p31(comet) induces tumor cell senescence by mediating p21(Waf1/Cip1) accumulation and Mad2 disruption and that these effects are dependent on a direct interaction of p31(comet) with Mad2.
18022368 Data suggest that p31(comet)(CMT2) exploits the two-state behavior of Mad2 to block its activation by acting as an "anti-Mad2."
17934339 p31(comet) does not have an impact on the formation of aneuploidy and tetraploidy found in human hepatocellular carcinoma.
15257285 p31(comet, formerly known as Cmt2) counteracts the function of Mad2 and is required for the silencing of the spindle checkpoint

AA Sequence

MAAPEAEVLSSAAVPDLEWYEKSEETHASQIELLETSSTQEPLNASEAFCPRDCMVPVVFPGPVSQEGCC      1 - 70
QFTCELLKHIMYQRQQLPLPYEQLKHFYRKPSPQAEEMLKKKPRATTEVSSRKCQQALAELESVLSHLED     71 - 140
FFARTLVPRVLILLGGNALSPKEFYELDLSLLAPYSVDQSLSTAACLRRLFRAIFMADAFSELQAPPLMG    141 - 210
TVVMAQGHRNCGEDWFRPKLNYRVPSRGHKLTVTLSCGRPSIRTTAWEDYIWFQAPVTFKGFRE          211 - 274
//

Text Mined References (34)

PMID Year Title
26544187 2015 p31comet-Induced Cell Death Is Mediated by Binding and Inactivation of Mad2.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26324890 2015 Mode of interaction of TRIP13 AAA-ATPase with the Mad2-binding protein p31comet and with mitotic checkpoint complexes.
25416956 2014 A proteome-scale map of the human interactome network.
25092294 2014 Disassembly of mitotic checkpoint complexes by the joint action of the AAA-ATPase TRIP13 and p31(comet).
24596092 2014 Phosphorylation regulates the p31Comet-mitotic arrest-deficient 2 (Mad2) interaction to promote spindle assembly checkpoint (SAC) activity.
24131926 2013 Coordinated regulation of p31(Comet) and Mad2 expression is required for cellular proliferation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22566641 2012 Role of phosphorylation of Cdc20 in p31(comet)-stimulated disassembly of the mitotic checkpoint complex.
22544748 2012 Depletion of p31comet protein promotes sensitivity to antimitotic drugs.
22235654 2011 [Molecular pathogenesis of hereditary motor and sensory neuropathy].
22100920 2011 p31comet-mediated extraction of Mad2 from the MCC promotes efficient mitotic exit.
21965286 2011 p31(comet) acts to ensure timely spindle checkpoint silencing subsequent to kinetochore attachment.
21937719 2011 Defining pathways of spindle checkpoint silencing: functional redundancy between Cdc20 ubiquitination and p31(comet).
21772247 2011 Probing the in vivo function of Mad1:C-Mad2 in the spindle assembly checkpoint.
21666598 2011 Shugoshin is a Mad1/Cdc20-like interactor of Mad2.
21300909 2011 p31comet Promotes disassembly of the mitotic checkpoint complex in an ATP-dependent process.
19276188 2009 p31comet Induces cellular senescence through p21 accumulation and Mad2 disruption.
19060904 2009 An empirical framework for binary interactome mapping.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18022368 2007 p31comet blocks Mad2 activation through structural mimicry.
17934339 2007 Mutation analysis of p31comet gene, a negative regulator of Mad2, in human hepatocellular carcinoma.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15257285 2004 Conformation-specific binding of p31(comet) antagonizes the function of Mad2 in the spindle checkpoint.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12456649 2002 Identification of a MAD2-binding protein, CMT2, and its role in mitosis.
11591653 2001 Protein-protein interaction panel using mouse full-length cDNAs.
10942595 2000 A visual intracellular classification strategy for uncharacterized human proteins.
7788527 1995 Prediction of the coding sequences of unidentified human genes. III. The coding sequences of 40 new genes (KIAA0081-KIAA0120) deduced by analysis of cDNA clones from human cell line KG-1.