Property Summary

NCBI Gene PubMed Count 9
PubMed Score 14.44
PubTator Score 3.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 2.400 2.4e-02
colon cancer -4.600 1.8e-06
ependymoma 3.400 6.3e-06
glioblastoma 1.300 4.7e-02
group 3 medulloblastoma 6.600 3.5e-07
inflammatory breast cancer -1.600 1.7e-02
malignant mesothelioma -2.400 3.4e-06
medulloblastoma, large-cell 7.000 3.9e-08
primitive neuroectodermal tumor 3.500 4.2e-02
psoriasis -1.300 1.8e-12

Gene RIF (4)

AA Sequence

MIAAQAKLVYQLNKYYTERCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSLSEIDARYEGLEVIS      1 - 70
PTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAV     71 - 140
DKCSYRDVVKMIADTSEVKLRIRERYVVQITPAFKCTGIWPRSAAQWPMPHIPWPGPNRVAEVKAEGFNL    141 - 210
LSKECYSLTGKQSSAESDAWVLQFGEAENRLLMGGCRNKCLSVLKTLRDRHLELPGQPLNNYHMKTLLLY    211 - 280
ECEKHPRETDWDESCLGDRLNGILLQLISCLQCRRCPHYFLPNLDLFQGKPHSALESAAKQTWRLAREIL    281 - 350
TNPKSLDKL                                                                 351 - 359
//

Text Mined References (10)

PMID Year Title