Property Summary

NCBI Gene PubMed Count 10
PubMed Score 9.69
PubTator Score 8.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
group 3 medulloblastoma 6.200 2.7e-04
medulloblastoma, large-cell 4.900 1.8e-03
posterior fossa group B ependymoma 1.800 2.3e-02
subependymal giant cell astrocytoma -4.484 6.6e-04
breast carcinoma -1.500 6.0e-22
ductal carcinoma in situ -1.500 1.1e-02
invasive ductal carcinoma -2.900 8.0e-05

Synonym

Accession Q13394 Q6I9T5
Symbols CAGR1
Nbla00126

Gene

PDB

5EOG   5EOM  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
21465527 MEF is involved in PTH suppression of osteoblasts through activating the MKK4/JNK1 pathway and subsequently up-regulating Mab21l1 expression.
11526470 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MIAAQAKLVYHLNKYYNEKCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSLNEMDNRYEGLEVIS      1 - 70
PTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAV     71 - 140
DKCSYRDVVKMVADTSEVKLRIRDRYVVQITPAFKCTGIWPRSAAHWPLPHIPWPGPNRVAEVKAEGFNL    141 - 210
LSKECHSLAGKQSSAESDAWVLQFAEAENRLQMGGCRKKCLSILKTLRDRHLELPGQPLNNYHMKTLVSY    211 - 280
ECEKHPRESDWDESCLGDRLNGILLQLISCLQCRRCPHYFLPNLDLFQGKPHSALENAAKQTWRLAREIL    281 - 350
TNPKSLEKL                                                                 351 - 359
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
21465527 2011 PTH regulates myleoid ELF-1-like factor (MEF)-induced MAB-21-like-1 (MAB21L1) expression through the JNK1 pathway.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15526290 2004 Molecular genetic analysis of human homologs of Caenorhabditis elegans mab-21-like 1 gene in patients with neural tube defects.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
12880961 2003 Neuroblastoma oligo-capping cDNA project: toward the understanding of the genesis and biology of neuroblastoma.
12826745 2002 Molecular genetic delineation of a deletion of chromosome 13q12-->q13 in a patient with autism and auditory processing deficits.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11526470 2001 Association and linkage studies between bipolar affective disorder and the polymorphic CAG/CTG repeat loci ERDA1, SEF2-1B, MAB21L and KCNN3.
10556287 1999 Two murine and human homologs of mab-21, a cell fate determination gene involved in Caenorhabditis elegans neural development.
9950369 1999 Unstable expansion of the CAG trinucleotide repeat in MAB21L1: report of a second pedigree and effect on protein expression.
9152839 1997 Meiotic instability associated with the CAGR1 trinucleotide repeat at 13q13.
8733127 1996 cDNA cloning of a human homologue of the Caenorhabditis elegans cell fate-determining gene mab-21: expression, chromosomal localization and analysis of a highly polymorphic (CAG)n trinucleotide repeat.