Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession M5A8F1
Symbols C21orf105
NDUFV3-AS1

Gene

 GO Component (1)

 GO Process (1)

 Compartment GO Term (0)

AA Sequence

MACIYPTTFYTSLPTKSLNMGISLTTILILSVAVLLSTAAPPSCRECYQSLHYRGEMQQYFTYHTHIERS      1 - 70
CYGNLIEECVESGKSYYKVKNLGVCGSRNGAICPRGKQWLCFTKIGQWGVNTQVLEDIKREQIIAKAKAS     71 - 140
KPTTPPENRPRHFHSFIQKL                                                      141 - 160
//

Text Mined References (6)

PMID Year Title