Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession M5A8F1
Symbols C21orf105
NDUFV3-AS1

Gene

 GO Component (1)

 GO Process (1)

 Compartment GO Term (0)

AA Sequence

MACIYPTTFYTSLPTKSLNMGISLTTILILSVAVLLSTAAPPSCRECYQSLHYRGEMQQYFTYHTHIERS      1 - 70
CYGNLIEECVESGKSYYKVKNLGVCGSRNGAICPRGKQWLCFTKIGQWGVNTQVLEDIKREQIIAKAKAS     71 - 140
KPTTPPENRPRHFHSFIQKL                                                      141 - 160
//

Text Mined References (6)

PMID Year Title
25653437 2015 Fighting fire with fire: endogenous retrovirus envelopes as restriction factors.
23492904 2013 A novel human endogenous retroviral protein inhibits cell-cell fusion.
21542922 2011 A revised nomenclature for transcribed human endogenous retroviral loci.
18158183 2008 Cellular localization of placenta-specific human endogenous retrovirus (HERV) transcripts and their possible implication in pregnancy-induced hypertension.
15533715 2004 Expression analyses of human endogenous retroviruses (HERVs): tissue-specific and developmental stage-dependent expression of HERVs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.