Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.53
PubTator Score 2.11

Knowledge Summary


No data available


  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 1.0e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Sertoli cell-only syndrome 37 3.724 1.9


  Differential Expression (1)

Disease log2 FC p
osteosarcoma -2.948 1.0e-06

Gene RIF (2)

AA Sequence

VAPLPMTPVPGRASKMPAASKSSSDAFFLPSEWEKDPSRP                                  491 - 530

Text Mined References (11)

PMID Year Title