Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 7.32559707128975E-17

AA Sequence

MPCPRPFWLRHSRAPQGSGPSSPGSLSAPRSPSRGEDQEEEEEEEGDGSPGSGPILPPASPVECLICVSS      1 - 70
FDGVFKLPKRLDCGHVFCLECLARLSLATAGGGNAVACPVCRAPTRLAPRRGLPALPTQSGLLPRDARAP     71 - 140
PSRQGSVRFDRRRGLLYLRPPPPPPGPRKARAPPPPPPLRLGRPLSRRLSLASPAWVFNAAVALAVLVAA    141 - 210
GLVVSGVYIFFLIPHATSSGPPRPQLVALAPAPGFSWFPPRPPPGSPWAPAWTPRPTGPDLDTALPGTAE    211 - 280
DALEPEAGPEDPAEAERTLDRRSDGTWGTEAGPGWAPWPRGARRLWGSQ                         281 - 329
//

Text Mined References (1)

PMID Year Title
15057824 2004 The DNA sequence and biology of human chromosome 19.