Property Summary

NCBI Gene PubMed Count 30
PubMed Score 38.32
PubTator Score 36.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 4.500 7.1e-10
astrocytic glioma -2.500 2.0e-03
ependymoma -2.600 2.7e-03
oligodendroglioma -1.800 8.3e-03
cystic fibrosis -2.124 1.2e-06
atypical teratoid / rhabdoid tumor -1.400 2.0e-02
intraductal papillary-mucinous adenoma (... -1.800 3.8e-04
intraductal papillary-mucinous carcinoma... -1.600 1.5e-03
Breast cancer 2.300 2.7e-02
ovarian cancer 2.000 1.9e-05

Gene RIF (18)

PMID Text
26653561 Compared with the normal hepatocyte cells, LZTS1 expression in hepatocellular carcinoma cells was significantly lower
26504261 missense variant in the LZTS1 gene was identified in two Ehlers-Danlos syndrome patients in an extended family.
25938461 miR-135b expression inversely correlated with LZTS1 staining intensity and the Cutaneous Squamous Cell Carcinoma grade.
25813822 LZTS1 promoter was frequently methylated in IMPC samples.
25667121 Suggest that LZTS1 plays a potential tumor suppressor role in colorectal cancer progression and represents a valuable clinical prognostic marker of this disease.
24802407 miR-214 functions as an onco-miRNA in osteosarcoma, and its oncogenic effects are mediated chiefly through downregulation of LZTS1
24448468 Lzts1 was significantly downregulated in breast cancer samples and its deregulation was associated with a higher incidence of tumor recurrence, and to a worse overall survival.
23695671 Expression of miR-135b, LZTS1, LATS2 and nuclear TAZ predicts poor outcomes of non-small-cell lung cancer.
21419475 Lower levels of leucine zipper putative tumor suppressor 1 correlated with high histologic grade, lymph node metastasis, and poor prognosis.
20508983 Observational study of gene-disease association. (HuGE Navigator)
20083228 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19885841 The reduction or loss of FEZ1 protein could be an aid to the clinical management of patients affected by ovarian carcinoma.
19339270 Observational study of gene-disease association. (HuGE Navigator)
18686028 Down-regulation of tumor suppressor gene FEZ1/LZTS1 in breast carcinoma involves promoter methylation and associates with metastasis.
18559591 Forced expression of LZTS1 in metastasizing uveal melanoma cells inhibited their motility and invasion, whereas depletion of LZTS1 increased their motility.
12851677 Down-regulation of FEZ1/LZTS1 gene with frequent loss of heterozygosity is associated with oral squamous cell carcinomas
12377406 Observational study of gene-disease association. (HuGE Navigator)
12377406 variation in the germline sequence is associated with prostate cancer risk

AA Sequence

MGSVSSLISGHSFHSKHCRASQYKLRKSSHLKKLNRYSDGLLRFGFSQDSGHGKSSSKMGKSEDFFYIKV      1 - 70
SQKARGSHHPDYTALSSGDLGGQAGVDFDPSTPPKLMPFSNQLEMGSEKGAVRPTAFKPVLPRSGAILHS     71 - 140
SPESASHQLHPAPPDKPKEQELKPGLCSGALSDSGRNSMSSLPTHSTSSSYQLDPLVTPVGPTSRFGGSA    141 - 210
HNITQGIVLQDSNMMSLKALSFSDGGSKLGHSNKADKGPSCVRSPISTDECSIQELEQKLLEREGALQKL    211 - 280
QRSFEEKELASSLAYEERPRRCRDELEGPEPKGGNKLKQASQKSQRAQQVLHLQVLQLQQEKRQLRQELE    281 - 350
SLMKEQDLLETKLRSYEREKTSFGPALEETQWEVCQKSGEISLLKQQLKESQTEVNAKASEILGLKAQLK    351 - 420
DTRGKLEGLELRTQDLEGALRTKGLELEVCENELQRKKNEAELLREKVNLLEQELQELRAQAALARDMGP    421 - 490
PTFPEDVPALQRELERLRAELREERQGHDQMSSGFQHERLVWKEEKEKVIQYQKQLQQSYVAMYQRNQRL    491 - 560
EKALQQLARGDSAGEPLEVDLEGADIPYEDIIATEI                                      561 - 596
//

Text Mined References (32)

PMID Year Title
26653561 2015 The tumor-suppressor gene LZTS1 suppresses hepatocellular carcinoma proliferation by impairing PI3K/Akt pathway.
26504261 2015 Ehlers-Danlos Syndrome, Hypermobility Type, Is Linked to Chromosome 8p22-8p21.1 in an Extended Belgian Family.
25938461 2015 MicroRNA-135b Regulates Leucine Zipper Tumor Suppressor 1 in Cutaneous Squamous Cell Carcinoma.
25813822 2015 Loss of Leucine Zipper Putative Tumor Suppressor 1 (LZTS1) Expression Contributes to Lymph Node Metastasis of Breast Invasive Micropapillary Carcinoma.
25667121 2015 The tumor-suppressor gene LZTS1 suppresses colorectal cancer proliferation through inhibition of the AKT-mTOR signaling pathway.
24802407 2014 miR-214 promotes the proliferation and invasion of osteosarcoma cells through direct suppression of LZTS1.
24448468 2014 LZTS1 downregulation confers paclitaxel resistance and is associated with worse prognosis in breast cancer.
23695671 2013 MicroRNA-135b promotes lung cancer metastasis by regulating multiple targets in the Hippo pathway and LZTS1.
23620142 2013 Genome-wide and gene-centric analyses of circulating myeloperoxidase levels in the charge and care consortia.
23551011 2013 Genome-wide association study of pre-eclampsia detects novel maternal single nucleotide polymorphisms and copy-number variants in subsets of the Hyperglycemia and Adverse Pregnancy Outcome (HAPO) study cohort.
23259602 2012 Genome-wide association scan of dental caries in the permanent dentition.
23064961 2013 GWAS of dental caries patterns in the permanent dentition.
22354037 2012 Genome-wide siRNA screen reveals amino acid starvation-induced autophagy requires SCOC and WAC.
21419475 2011 Down-regulation of leucine zipper putative tumor suppressor 1 is associated with poor prognosis, increased cell motility and invasion, and epithelial-to-mesenchymal transition characteristics in human breast carcinoma.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20083228 2010 Genome-wide analysis of chromosomal alterations in patients with esophageal squamous cell carcinoma exposed to tobacco and betel quid from high-risk area in India.
20038947 2011 Novel loci for major depression identified by genome-wide association study of Sequenced Treatment Alternatives to Relieve Depression and meta-analysis of three studies.
19885841 2010 FEZ1/LZTS1 protein expression in ovarian cancer.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19339270 2009 Genetic associations of 115 polymorphisms with cancers of the upper aerodigestive tract across 10 European countries: the ARCAGE project.
18686028 2009 Down-regulation of tumor suppressor gene FEZ1/LZTS1 in breast carcinoma involves promoter methylation and associates with metastasis.
18559591 2008 A metastasis modifier locus on human chromosome 8p in uveal melanoma identified by integrative genomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17349584 2007 Fez1/Lzts1 absence impairs Cdk1/Cdc25C interaction during mitosis and predisposes mice to cancer development.
16484223 2006 FEZ1 dimerization and interaction with transcription regulatory proteins involves its coiled-coil region.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12851677 2003 Down-regulation of FEZ1/LZTS1 gene with frequent loss of heterozygosity in oral squamous cell carcinomas.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12377406 2002 Germline sequence variants of the LZTS1 gene are associated with prostate cancer risk.
11504921 2001 FEZ1/LZTS1 gene at 8p22 suppresses cancer cell growth and regulates mitosis.
11464283 2001 Functional identification of LZTS1 as a candidate prostate tumor suppressor gene on human chromosome 8p22.
10097140 1999 The FEZ1 gene at chromosome 8p22 encodes a leucine-zipper protein, and its expression is altered in multiple human tumors.