Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.44
PubTator Score 2.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 3.3e-05
osteosarcoma 7950 1.2e-03
diabetes mellitus 1728 1.6e-03
group 3 medulloblastoma 4104 2.7e-03
Disease Target Count Z-score Confidence
Schnyder Corneal Dystrophy 23 4.299 2.1

Expression

  Differential Expression (4)

Disease log2 FC p
diabetes mellitus -1.200 1.6e-03
group 3 medulloblastoma 1.500 2.7e-03
osteosarcoma 1.089 1.2e-03
ovarian cancer 1.700 3.3e-05

Gene RIF (2)

AA Sequence

MASRGKTETSKLKQNLEEQLDRLMQQLQDLEECREELDTDEYEETKKETLEQLSEFNDSLKKIMSGNMTL      1 - 70
VDELSGMQLAIQAAISQAFKTPEVIRLFAKKQPGQLRTRLAEMDRDLMVGKLERDLYTQQKVEILTALRK     71 - 140
LGEKLTADDEAFLSANAGAILSQFEKVSTDLGSGDKILALASFEVEKTKK                        141 - 190
//

Text Mined References (10)

PMID Year Title