Property Summary

NCBI Gene PubMed Count 87
PubMed Score 4321.01
PubTator Score 3490.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
lung carcinoma 2844 9.2e-28
Duchenne muscular dystrophy 602 1.8e-10
breast carcinoma 1614 3.7e-10
chronic lymphosyte leukemia 232 2.8e-09
lung cancer 4473 5.0e-07
psoriasis 6685 5.1e-07
pilocytic astrocytoma 3086 1.1e-06
posterior fossa group A ependymoma 1511 1.5e-06
juvenile dermatomyositis 1189 3.3e-06
non-small cell lung cancer 2798 1.2e-05
active Crohn's disease 918 3.8e-05
active ulcerative colitis 477 1.2e-04
atypical teratoid / rhabdoid tumor 4369 2.0e-04
ovarian cancer 8491 2.3e-04
limb girdle muscular dystrophy 2I 56 5.7e-04
lung adenocarcinoma 2714 9.4e-04
adult high grade glioma 2148 9.4e-04
glioblastoma 5572 1.4e-03
Becker muscular dystrophy 187 2.2e-03
dermatomyositis 966 2.6e-03
intraductal papillary-mucinous adenoma (IPMA) 2956 3.6e-03
invasive ductal carcinoma 2950 6.2e-03
pancreatic cancer 2300 6.9e-03
cutaneous lupus erythematosus 1056 7.3e-03
medulloblastoma 1524 8.1e-03
Waldenstrons macroglobulinemia 764 9.7e-03
diabetes mellitus 1663 1.3e-02
interstitial cystitis 2299 1.4e-02
autosomal dominant Emery-Dreifuss muscular dystrophy 499 1.7e-02
esophageal adenocarcinoma 737 1.9e-02
Breast cancer 3098 2.2e-02
primitive neuroectodermal tumor 3031 2.2e-02
Barrett's esophagus 185 2.5e-02
osteosarcoma 7933 2.8e-02
nephrosclerosis 329 3.1e-02
chronic rhinosinusitis 512 3.2e-02
chronic kidney disease 90 3.9e-02
intraductal papillary-mucinous carcinoma (IPMC) 2988 4.5e-02
ductal carcinoma in situ 1745 4.5e-02
non primary Sjogren syndrome sicca 840 5.0e-02
Disease Target Count Z-score Confidence
Amyloidosis 68 6.634 3.3
Disease Target Count
Amyloidosis, familial visceral 4
Disease Target Count
Amyloidosis 8 4

Expression

  Differential Expression (41)

Disease log2 FC p
nephrosclerosis 1.472 3.1e-02
Waldenstrons macroglobulinemia 3.229 9.7e-03
chronic lymphosyte leukemia -4.200 2.8e-09
Barrett's esophagus 3.200 2.5e-02
esophageal adenocarcinoma 3.500 1.9e-02
cutaneous lupus erythematosus 1.400 7.3e-03
glioblastoma 4.000 1.4e-03
osteosarcoma -1.675 2.8e-02
posterior fossa group A ependymoma 2.300 1.5e-06
atypical teratoid / rhabdoid tumor 2.500 2.0e-04
medulloblastoma 1.600 8.1e-03
primitive neuroectodermal tumor 2.200 2.2e-02
Duchenne muscular dystrophy 3.021 1.8e-10
limb girdle muscular dystrophy 2I 2.454 5.7e-04
autosomal dominant Emery-Dreifuss muscul... 1.214 1.7e-02
Becker muscular dystrophy 2.086 2.2e-03
juvenile dermatomyositis 1.583 3.3e-06
chronic kidney disease 2.400 3.9e-02
tuberculosis 1.400 1.3e-07
non-small cell lung cancer -1.654 1.2e-05
intraductal papillary-mucinous adenoma (... 3.900 3.6e-03
intraductal papillary-mucinous carcinoma... 2.000 4.5e-02
lung cancer -4.600 5.0e-07
active Crohn's disease 4.876 3.8e-05
active ulcerative colitis 4.566 1.2e-04
pancreatic cancer 2.000 6.9e-03
breast carcinoma 1.800 3.7e-10
diabetes mellitus -2.800 1.3e-02
Breast cancer 3.400 2.2e-02
interstitial cystitis 4.200 1.4e-02
adult high grade glioma 3.000 9.4e-04
pilocytic astrocytoma 2.700 1.1e-06
non primary Sjogren syndrome sicca 1.500 5.0e-02
psoriasis 2.900 5.1e-07
lung adenocarcinoma -1.700 9.4e-04
invasive ductal carcinoma 3.500 6.2e-03
lung carcinoma -3.600 9.2e-28
ductal carcinoma in situ 1.700 4.5e-02
ovarian cancer -3.200 2.3e-04
chronic rhinosinusitis 2.718 3.2e-02
dermatomyositis 2.400 2.6e-03

Synonym

Accession P61626 P00695 Q13170 Q9UCF8
Symbols LZM
LYZF1

Gene

LYZ

PDB

133L   134L   1B5U   1B5V   1B5W   1B5X   1B5Y   1B5Z   1B7L   1B7M   1B7N   1B7O   1B7P   1B7Q   1B7R   1B7S   1BB3   1BB4   1BB5   1C43   1C45   1C46   1C7P   1CJ6   1CJ7   1CJ8   1CJ9   1CKC   1CKD   1CKF   1CKG   1CKH   1D6P   1D6Q   1DI3   1DI4   1DI5   1EQ4   1EQ5   1EQE   1GAY   1GAZ   1GB0   1GB2   1GB3   1GB5   1GB6   1GB7   1GB8   1GB9   1GBO   1GBW   1GBX   1GBY   1GBZ   1GDW   1GDX   1GE0   1GE1   1GE2   1GE3   1GE4   1GEV   1GEZ   1GF0   1GF3   1GF4   1GF5   1GF6   1GF7   1GF8   1GF9   1GFA   1GFE   1GFG   1GFH   1GFJ   1GFK   1GFR   1GFT   1GFU   1GFV   1HNL   1I1Z   1I20   1I22   1INU   1IOC   1IP1   1IP2   1IP3   1IP4   1IP5   1IP6   1IP7   1IWT   1IWU   1IWV   1IWW   1IWX   1IWY   1IWZ   1IX0   1IY3   1IY4   1JKA   1JKB   1JKC   1JKD   1JSF   1JWR   1LAA   1LHH   1LHI   1LHJ   1LHK   1LHL   1LHM   1LMT   1LOZ   1LYY   1LZ1   1LZ4   1LZ5   1LZ6   1LZR   1LZS   1OP9   1OUA   1OUB   1OUC   1OUD   1OUE   1OUF   1OUG   1OUH   1OUI   1OUJ   1QSW   1RE2   1REM   1REX   1REY   1REZ   1TAY   1TBY   1TCY   1TDY   1UBZ   1W08   1WQM   1WQN   1WQO   1WQP   1WQQ   1WQR   1YAM   1YAN   1YAO   1YAP   1YAQ   207L   208L   2BQA   2BQB   2BQC   2BQD   2BQE   2BQF   2BQG   2BQH   2BQI   2BQJ   2BQK   2BQL   2BQM   2BQN   2BQO   2HEA   2HEB   2HEC   2HED   2HEE   2HEF   2LHM   2MEA   2MEB   2MEC   2MED   2MEE   2MEF   2MEG   2MEH   2MEI   2NWD   2ZIJ   2ZIK   2ZIL   2ZWB   3EBA   3FE0   3LHM   3LN2   4I0C   4ML7   4R0P  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (50)

PMID Text
26366224 the possible relationship between ocular symptomatology, tear volume and tear break-up time (TBUT) and lipocalin, lactoferrin and lysozyme concentrations in the tear film were explored in a group of symptomatic dry-eyed postmenopausal (PM) women.
25914748 Tear lysozyme, lactoferrin and lipocalin concentrations were determined via electrophoresis and the results for patients with or without eyelid tumors were compared.
25706123 Data show that transgenic hens with stable expression of recombinant human lysozyme proteins can be created by microinjection of lentiviral vectors.
25659958 Accumulation of pathogenic lysozymes in the endoplasmic reticulum caused ER stress and the unfolded protein response mainly via the IRE1alpha pathway.
25575179 The determination of the structure of a low-population intermediate in the product release process by human lysozyme, is reported.
25236863 Both the hLF and hLZ were expressed in the mammary gland of bi-transgenic pigs, as detected by western blotting.Interestingly, pig milk containing hLF and hLZ had synergistic antimicrobial activity
25217048 Hereditary amyloidosis associated with the p.Trp82Arg lysozyme variant in this new family is predominantly associated with mild upper gastrointestinal tract involvement and in some cases with inflammatory bowel disease.
24495950 the protective action of lysozyme on the nephrotoxic effects of advanced glycation end products depend on ability to prevent the production and release of inflammatory mediators, such as IL-6 and to reduce macrophage recruitment in the inflammatory sites.
24340941 The dynamics of changes in lysozyme activity and content of lactoferrin content of patients with chronic osteomyelitis
24308818 Data suggest that the invariant loop of PliC (periplasmic inhibitor of c-type lysozyme) from Brucella abortus plays crucial role in inhibition of human c-type lysozyme via its insertion into the active site cleft of lysozyme.
24296430 Lzm-S can deposit in the systemic vasculature and kidneys in SS, where this deposition could lead to acute organ dysfunction.
24121782 Both mRNA and protein levels of lysozyme were significantly higher in patients with biofilm associated chronic rhinosinusitis (CRS) than those with CRS and no biofilm and controls.
23898208 Tandem affinity purification and mass spectrometry analysis identify lysozyme (LYZ), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23264227 The purpose of this study was to evaluate the effect of chronic alcohol intoxication and smoking on the concentration and output of salivary lysozyme.
23155290 Lysozyme is up-regulated in Barrett's mucosa
23125841 Tandem affinity purification and mass spectrometry analysis identify lysozyme (LYZ), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22096116 When Lzm-S was located in close proximity to vascular smooth muscle cells, it could generate H(2)O(2) to produce lengthening in a human cell culture preparation.
21965601 We observed that expressing the destabilized F57I and D67H lysozymes triggers unfolded protein response activation, resulting in degradation of these variants.
21574221 The degree of residual structure of lysozyme correlates with the ability of the protein to form amyloid fibrils.
21486364 Lysozyme is up-regulated in Barrett's mucosa
21460390 increased production of the antibacterial enzyme lysozyme was found in collagenous colitis and lymphocytic colitis
20673868 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20167661 Raised plasma lysozyme levels may be a useful biomarker of atherosclerotic cardiovascular disease and response to therapy.
19563039 There was no difference in the concentration of lysozyme in children with dental caries than that in controls.
19435495 Results show that the cationic nature is not a major determinant in the anti-HSV action of mucosal innate cationic polypeptides, since whereas human Lactoferrin inhibited HSV-1 infection efficiently, human lysozyme had no HSV-1 inhibiting activity.
19179970 Lysozyme activity in crevicular fluid and in unstimulated saliva correlated with periodontal pocket depth in donors and in patients with gingivitis or periodontitis.
18434581 High salivary lysozyme levels are associated with the odds of hypertension.
18344136 short-duration, high-intensity exercise increases the secretion rate of salivary Lysozyme despite no change in the saliva flow rate.
18029788 The influence of mutant signal peptides on enzymatic activity of lysozyme at high pH or ionic strength were studied.
17524359 Thus, we provide a novel strategy for engineering the active site of enzymes.
17407782 Clusterin, and perhaps other extracellular chaperones, could have a key role in curtailing the potentially pathogenic effects of the misfolding and aggregation of proteins that, like lysozyme, are secreted into the extracellular environment.
17360367 The structure of the synthetic human lysozyme was confirmed by high-resolution x-ray diffraction, giving the highest-resolution structure (1.04 A) observed to date for this enzyme.
17054380 The distortion of the hydrophobic core at the alpha- and beta-interface putatively results in the formation of the initial "seed" for amyloid fibril.
16799949 report a case of hepatic rupture secondary to hereditary lysozyme amyloidosis that was successfully treated by liver transplantation
16441658 findings indicate that a complex interplay between reduced native-state stability, lower secretion levels, and protein aggregation propensity influences the types of mutation that give rise to familial forms of amyloid disease
16416029 Lysozyme functions as an antimicrobial peptide, with antibacterial activity.
16329101 A novel form of systemic ALys amyloidosis, caused by compound heterozygosity in exon 2 (p.T70N) and exon 4 (p.W112R) of the lysozyme gene (LYZ), with both mutations being present on the same allele.
16126226 Data suggest that partial unfolding is an intrinsic property of the human lysozyme structure, and suggest that the readiness with which it occurs is a critical feature determining whether or not amyloid deposition occurs in vivo.
16023673 the ensemble of reduced denatured conformers initially collapses into a large number of unstructured intermediates with one or two disulphide bonds, the majority of which then fold to form the native-like three-disulphide intermediate, des-[77-95]
15713462 amyloidogenic variants, I56T and D67H, show a specific, partly unfolded intermediate state under physiologically relevant conditions
15155566 Hydrostatic pressure (3.5 kbar at 57 degrees C, pH 7.4) was used to make amyloidogenic states of WT & variant(Ile56Thr & Asp67His) lysozymes by inducing a conformational state of lysozyme that aggregates readily upon decompression.
14976184 promyelocytic leukemia protein, but not Sp100, induced the accumulation of MEF in PML nuclear bodies and MEF and PML physically interacted, stimulating MEF transcriptional activity, resulting in the up-regulation of endogenous lysozyme expression.
12709420 Structural and folding dynamic properties of human lysozyme T70N variant
12564923 Detailed comparison between the 35 degree C and 4 degree C structures of lysozyme revealed for the first time that an active site lobe has a structural ability to obstruct the polysaccharide-binding cleft only by temperature lowering without a substrate.
12183536 Streptococcal inhibitor of complement inhibits two additional components of the mucosal innate immune system: secretory leukocyte proteinase inhibitor and lysozyme.
11986950 up-regulated by the AML1-MTG8 fusion protein, suggesting a role in the granulocytic maturation characteristic of the t(8;21) acute myelogenous leukemia
11927576 Positive contribution of hydration structure on the surface of human lysozyme to the conformational stability.
11887182 Local cooperativity in the unfolding of an amyloidogenic variant of human lysozyme
10561612 a residue at the N-terminal of lysozyme is required for hydrogen bond networks with ordered water molecules and stabilization of the protein.

AA Sequence

MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRST      1 - 70
DYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVR     71 - 140
QYVQGCGV                                                                  141 - 148
//

Text Mined References (90)

PMID Year Title
26366224 2015 Tear lipocalin, lysozyme and lactoferrin concentrations in postmenopausal women.
25946035 2015 Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25914748 Correlations between eyelid tumors and tear lipocalin, lysozyme and lactoferrin concentrations in postmenopausal women.
25706123 2015 Expression of recombinant human lysozyme in egg whites of transgenic hens.
25659958 2015 Amyloidogenic lysozymes accumulate in the endoplasmic reticulum accompanied by the augmentation of ER stress signals.
25575179 2015 Structure of a low-population intermediate state in the release of an enzyme product.
25236863 2015 Generation of bi-transgenic pigs overexpressing human lactoferrin and lysozyme in milk.
25217048 2014 A new family with hereditary lysozyme amyloidosis with gastritis and inflammatory bowel disease as prevailing symptoms.
24495950 2014 Human recombinant lysozyme downregulates advanced glycation endproduct-induced interleukin-6 production and release in an in-vitro model of human proximal tubular epithelial cells.
24340941 2013 [The dynamics of changes in lysozyme activity and content of lactoferrin content of patients with chronic osteomyelitis].
24308818 2013 Structural basis for the inhibition of human lysozyme by PliC from Brucella abortus.
24296430 2014 Lysozyme, a mediator of sepsis that deposits in the systemic vasculature and kidney as a possible mechanism of acute organ dysfunction.
24121782 2014 Enhanced expressions of lysozyme, SLPI and glycoprotein 340 in biofilm-associated chronic rhinosinusitis.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23353684 2013 Protease-activated alpha-2-macroglobulin can inhibit amyloid formation via two distinct mechanisms.
23264227 2012 Salivary lysozyme in smoking alcohol dependent persons.
23155290 2012 Lysozyme is up-regulated in columnar-lined Barrett's mucosa: a possible natural defence mechanism against Barrett's esophagus-associated pathogenic bacteria.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22096116 2012 Mechanisms of systemic vasodilation by lysozyme-c in septic shock.
21965601 2012 Disease-related amyloidogenic variants of human lysozyme trigger the unfolded protein response and disturb eye development in Drosophila melanogaster.
21574221 2011 Characteristics of human lysozyme and its disease-related mutants in their unfolded states.
21486364 2011 Lysozyme is up-regulated in Barrett's mucosa.
21460390 2011 Lysozyme expression in microscopic colitis.
21269460 2011 Initial characterization of the human central proteome.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20167661 2010 Identification and assessment of plasma lysozyme as a putative biomarker of atherosclerosis.
19563039 2009 [Relationship of concentration of lactoferrin and lysozyme in saliva and dental caries in primary dentition].
19435495 2009 Human lactoferrin but not lysozyme neutralizes HSV-1 and inhibits HSV-1 replication and cell-to-cell spread.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19179970 2009 Lysozyme and microbiota in relation to gingivitis and periodontitis.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18591461 2008 Genomic association analysis suggests chromosome 12 locus influencing antihypertensive response to thiazide diuretic.
18434581 2008 Salivary lysozyme and prevalent hypertension.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18344136 2008 Effects of exercise intensity on salivary antimicrobial proteins and markers of stress in active men.
18029788 2007 Effect of N-terminal mutation of human lysozyme on enzymatic activity.
17524359 2007 Exon grafting yields a "two active-site" lysozyme.
17407782 2007 The extracellular chaperone clusterin potently inhibits human lysozyme amyloid formation by interacting with prefibrillar species.
17360367 2007 Convergent chemical synthesis and high-resolution x-ray structure of human lysozyme.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17054380 2006 Structural analysis of human lysozyme using molecular dynamics simulations.
16799949 2006 Hereditary lysozyme amyloidosis: spontaneous hepatic rupture (15 years apart) in mother and daughter. role of emergency liver transplantation.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16441658 2006 Impact of the native-state stability of human lysozyme variants on protein secretion by Pichia pastoris.
16416029 2006 Antimicrobial skin peptides and proteins.
16329101 2006 ALys amyloidosis caused by compound heterozygosity in exon 2 (Thr70Asn) and exon 4 (Trp112Arg) of the lysozyme gene.
16126226 2005 Rationalising lysozyme amyloidosis: insights from the structure and solution dynamics of T70N lysozyme.
16023673 2005 Oxidative refolding of amyloidogenic variants of human lysozyme.
15745733 2005 Underdiagnosed amyloidosis: amyloidosis of lysozyme variant.
15713462 2005 Reduced global cooperativity is a common feature underlying the amyloidogenicity of pathogenic lysozyme mutations.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15155566 2004 Formation of amyloid aggregates from human lysozyme and its disease-associated variants using hydrostatic pressure.
14976184 2004 Myeloid Elf-1-like factor, an ETS transcription factor, up-regulates lysozyme transcription in epithelial cells through interaction with promyelocytic leukemia protein.
12709420 2003 Structural and folding dynamic properties of the T70N variant of human lysozyme.
12675840 2003 A novel lysozyme mutation Phe57Ile associated with hereditary renal amyloidosis.
12564923 2003 Low-temperature-induced structural changes in human lysozyme elucidated by three-dimensional NMR spectroscopy.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12183536 2002 Streptococcal inhibitor of complement inhibits two additional components of the mucosal innate immune system: secretory leukocyte proteinase inhibitor and lysozyme.
11986950 2002 Potential involvement of the AML1-MTG8 fusion protein in the granulocytic maturation characteristic of the t(8;21) acute myelogenous leukemia revealed by microarray analysis.
11946554 1972 A val-val sequence found in a human monocytic leukemia lysozyme.
11946553 1972 Comparison between human and bird lysozymes: Note concerning the previously observed deletion.
11849445 2002 Hereditary renal amyloidosis caused by a new variant lysozyme W64R in a French family.
10561612 1999 Effect of foreign N-terminal residues on the conformational stability of human lysozyme.
10558865 1999 Interaction of tear lipocalin with lysozyme and lactoferrin.
10534505 1999 Hereditary renal amyloidosis associated with variant lysozyme in a large English family.
9883972 1998 A novel anti-inflammatory activity of lysozyme: modulation of serum complement activation.
9757091 1998 Structures of monoclinic lysozyme iodide at 1.6 A and of triclinic lysozyme nitrate at 1.1 A.
9745729 1998 Mexoryl SX: a broad absorption UVA filter protects human skin from the effects of repeated suberythemal doses of UVA.
9659355 1998 Preferential binding of lysozyme to elastic fibres in pulmonary emphysema.
9359845 1997 N-terminal stretch Arg2, Arg3, Arg4 and Arg5 of human lactoferrin is essential for binding to heparin, bacterial lipopolysaccharide, human lysozyme and DNA.
8765309 1996 alpha-Lactalbumins and lysozymes.
8566845 1996 'Fragile' liver and massive hepatic haemorrhage due to hereditary amyloidosis.
8503881 1993 Indication of possible post-translational formation of disulphide bonds in the beta-sheet domain of human lysozyme.
8464497 1993 Human lysozyme gene mutations cause hereditary systemic amyloidosis.
7334520 1981 Refinement of human lysozyme at 1.5 A resolution analysis of non-bonded and hydrogen-bond interactions.
6876162 1983 X-ray studies of water in crystals of lysozyme.
5284421 1971 Primary structure of lysozymes from man and goose.
5168859 1971 Human milk lysozyme: unpublished data concerning the establishment of the complete primary structure; comparison with lysozymes of various origins.
3413092 1988 Cloning the human lysozyme cDNA: inverted Alu repeat in the mRNA and in situ hybridization for macrophages and Paneth cells.
2971592 1988 Cloning of human lysozyme gene and expression in the yeast Saccharomyces cerevisiae.
2829884 1988 Human lysozyme: sequencing of a cDNA, and expression and secretion by Saccharomyces cerevisiae.
2546758 1989 The human lysozyme gene. Sequence organization and chromosomal localization.
2207098 1990 1H NMR studies of human lysozyme: spectral assignment and comparison with hen lysozyme.
2061330 1991 The crystal structure of a mutant human lysozyme C77/95A with increased secretion efficiency in yeast.
1794972 1991 1H and 15N NMR study of human lysozyme.
366724 Human lysozyme (origin and distribution in health and disease).