Property Summary

NCBI Gene PubMed Count 98
PubMed Score 4460.08
PubTator Score 3490.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Amyloidosis, familial visceral 4 0.0 0.0
Disease Target Count P-value
lung carcinoma 2843 9.2e-28
Duchenne muscular dystrophy 601 1.8e-10
psoriasis 6694 4.3e-08
tuberculosis 2010 1.3e-07
ovarian cancer 8520 2.8e-07
lung cancer 4740 2.3e-06
juvenile dermatomyositis 1187 3.3e-06
non-small cell lung cancer 2890 1.2e-05
active Crohn's disease 922 3.8e-05
limb girdle muscular dystrophy 2A 213 6.4e-05
active ulcerative colitis 764 1.2e-04
invasive ductal carcinoma 2951 2.1e-04
Astrocytoma, Pilocytic 3081 2.1e-04
ependymoma 4679 7.3e-04
lung adenocarcinoma 2716 9.4e-04
Chronic Lymphocytic Leukemia 262 2.0e-03
Becker muscular dystrophy 191 2.2e-03
glioblastoma 5792 2.4e-03
dermatomyositis 966 2.6e-03
group 3 medulloblastoma 4104 2.6e-03
intraductal papillary-mucinous adenoma (IPMA) 2955 3.6e-03
pancreatic cancer 2398 6.9e-03
cutaneous lupus erythematosus 1057 7.3e-03
Waldenstrons macroglobulinemia 765 9.7e-03
diabetes mellitus 1728 1.3e-02
interstitial cystitis 2312 1.4e-02
adult high grade glioma 3801 1.5e-02
autosomal dominant Emery-Dreifuss muscular dystrophy 510 1.7e-02
esophageal adenocarcinoma 737 1.9e-02
Breast cancer 3578 2.2e-02
primitive neuroectodermal tumor 3035 2.2e-02
Barrett's esophagus 182 2.5e-02
osteosarcoma 7950 2.8e-02
nephrosclerosis 333 3.1e-02
chronic rhinosinusitis 512 3.2e-02
chronic kidney disease 90 3.9e-02
atypical teratoid / rhabdoid tumor 5112 4.4e-02
intraductal papillary-mucinous carcinoma (IPMC) 2989 4.5e-02
ductal carcinoma in situ 1745 4.5e-02
breast carcinoma 1638 4.8e-02
non primary Sjogren syndrome sicca 891 5.0e-02
Disease Target Count Z-score Confidence
Amyloidosis 67 6.669 3.3

Expression

  Differential Expression (41)

Disease log2 FC p
tuberculosis 1.400 1.3e-07
active Crohn's disease 4.876 3.8e-05
active ulcerative colitis 4.505 1.2e-04
adult high grade glioma 1.400 1.5e-02
Astrocytoma, Pilocytic 1.600 2.1e-04
atypical teratoid / rhabdoid tumor 1.100 4.4e-02
autosomal dominant Emery-Dreifuss muscul... 1.214 1.7e-02
Barrett's esophagus 3.200 2.5e-02
Becker muscular dystrophy 2.086 2.2e-03
Breast cancer 3.400 2.2e-02
breast carcinoma 1.100 4.8e-02
chronic kidney disease 2.400 3.9e-02
Chronic Lymphocytic Leukemia -2.369 2.0e-03
chronic rhinosinusitis 2.718 3.2e-02
cutaneous lupus erythematosus 1.400 7.3e-03
dermatomyositis 2.400 2.6e-03
diabetes mellitus -2.800 1.3e-02
Duchenne muscular dystrophy 3.021 1.8e-10
ductal carcinoma in situ 1.700 4.5e-02
ependymoma 1.200 7.3e-04
esophageal adenocarcinoma 3.500 1.9e-02
glioblastoma 1.700 2.4e-03
group 3 medulloblastoma 1.400 2.6e-03
interstitial cystitis 4.200 1.4e-02
intraductal papillary-mucinous adenoma (... 3.900 3.6e-03
intraductal papillary-mucinous carcinoma... 2.000 4.5e-02
invasive ductal carcinoma 2.762 2.1e-04
juvenile dermatomyositis 1.583 3.3e-06
limb girdle muscular dystrophy 2A 1.949 6.4e-05
lung adenocarcinoma -1.700 9.4e-04
lung cancer -4.000 2.3e-06
lung carcinoma -3.600 9.2e-28
nephrosclerosis 1.472 3.1e-02
non primary Sjogren syndrome sicca 1.500 5.0e-02
non-small cell lung cancer -1.654 1.2e-05
osteosarcoma -1.675 2.8e-02
ovarian cancer -2.900 2.8e-07
pancreatic cancer 2.000 6.9e-03
primitive neuroectodermal tumor 2.200 2.2e-02
psoriasis 1.500 4.3e-08
Waldenstrons macroglobulinemia 3.229 9.7e-03

Synonym

Accession P61626 P00695 Q13170 Q9UCF8
Symbols LZM
LYZF1

Gene

LYZ

PDB

133L   134L   1B5U   1B5V   1B5W   1B5X   1B5Y   1B5Z   1B7L   1B7M   1B7N   1B7O   1B7P   1B7Q   1B7R   1B7S   1BB3   1BB4   1BB5   1C43   1C45   1C46   1C7P   1CJ6   1CJ7   1CJ8   1CJ9   1CKC   1CKD   1CKF   1CKG   1CKH   1D6P   1D6Q   1DI3   1DI4   1DI5   1EQ4   1EQ5   1EQE   1GAY   1GAZ   1GB0   1GB2   1GB3   1GB5   1GB6   1GB7   1GB8   1GB9   1GBO   1GBW   1GBX   1GBY   1GBZ   1GDW   1GDX   1GE0   1GE1   1GE2   1GE3   1GE4   1GEV   1GEZ   1GF0   1GF3   1GF4   1GF5   1GF6   1GF7   1GF8   1GF9   1GFA   1GFE   1GFG   1GFH   1GFJ   1GFK   1GFR   1GFT   1GFU   1GFV   1HNL   1I1Z   1I20   1I22   1INU   1IOC   1IP1   1IP2   1IP3   1IP4   1IP5   1IP6   1IP7   1IWT   1IWU   1IWV   1IWW   1IWX   1IWY   1IWZ   1IX0   1IY3   1IY4   1JKA   1JKB   1JKC   1JKD   1JSF   1JWR   1LAA   1LHH   1LHI   1LHJ   1LHK   1LHL   1LHM   1LMT   1LOZ   1LYY   1LZ1   1LZ4   1LZ5   1LZ6   1LZR   1LZS   1OP9   1OUA   1OUB   1OUC   1OUD   1OUE   1OUF   1OUG   1OUH   1OUI   1OUJ   1QSW   1RE2   1REM   1REX   1REY   1REZ   1TAY   1TBY   1TCY   1TDY   1UBZ   1W08   1WQM   1WQN   1WQO   1WQP   1WQQ   1WQR   1YAM   1YAN   1YAO   1YAP   1YAQ   207L   208L   2BQA   2BQB   2BQC   2BQD   2BQE   2BQF   2BQG   2BQH   2BQI   2BQJ   2BQK   2BQL   2BQM   2BQN   2BQO   2HEA   2HEB   2HEC   2HED   2HEE   2HEF   2LHM   2MEA   2MEB   2MEC   2MED   2MEE   2MEF   2MEG   2MEH   2MEI   2NWD   2ZIJ   2ZIK   2ZIL   2ZWB   3EBA   3FE0   3LHM   3LN2   4I0C   4ML7   4R0P   5LSH   5LVK  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (58)

AA Sequence

MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRST      1 - 70
DYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVR     71 - 140
QYVQGCGV                                                                  141 - 148
//

Text Mined References (101)

PMID Year Title