Property Summary

NCBI Gene PubMed Count 98
PubMed Score 4460.08
PubTator Score 3490.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Amyloidosis, familial visceral 4 0.0 0.0
Disease Target Count P-value
lung carcinoma 2843 9.2e-28
Duchenne muscular dystrophy 601 1.8e-10
psoriasis 6694 4.3e-08
tuberculosis 2010 1.3e-07
ovarian cancer 8520 2.8e-07
lung cancer 4740 2.3e-06
juvenile dermatomyositis 1187 3.3e-06
non-small cell lung cancer 2890 1.2e-05
active Crohn's disease 922 3.8e-05
limb girdle muscular dystrophy 2A 213 6.4e-05
active ulcerative colitis 764 1.2e-04
invasive ductal carcinoma 2951 2.1e-04
Astrocytoma, Pilocytic 3081 2.1e-04
ependymoma 4679 7.3e-04
lung adenocarcinoma 2716 9.4e-04
Chronic Lymphocytic Leukemia 262 2.0e-03
Becker muscular dystrophy 191 2.2e-03
glioblastoma 5792 2.4e-03
dermatomyositis 966 2.6e-03
group 3 medulloblastoma 4104 2.6e-03
intraductal papillary-mucinous adenoma (IPMA) 2955 3.6e-03
pancreatic cancer 2398 6.9e-03
cutaneous lupus erythematosus 1057 7.3e-03
Waldenstrons macroglobulinemia 765 9.7e-03
diabetes mellitus 1728 1.3e-02
interstitial cystitis 2312 1.4e-02
adult high grade glioma 3801 1.5e-02
autosomal dominant Emery-Dreifuss muscular dystrophy 510 1.7e-02
esophageal adenocarcinoma 737 1.9e-02
Breast cancer 3578 2.2e-02
primitive neuroectodermal tumor 3035 2.2e-02
Barrett's esophagus 182 2.5e-02
osteosarcoma 7950 2.8e-02
nephrosclerosis 333 3.1e-02
chronic rhinosinusitis 512 3.2e-02
chronic kidney disease 90 3.9e-02
atypical teratoid / rhabdoid tumor 5112 4.4e-02
intraductal papillary-mucinous carcinoma (IPMC) 2989 4.5e-02
ductal carcinoma in situ 1745 4.5e-02
breast carcinoma 1638 4.8e-02
non primary Sjogren syndrome sicca 891 5.0e-02
Disease Target Count Z-score Confidence
Amyloidosis 67 6.669 3.3

Expression

  Differential Expression (41)

Disease log2 FC p
tuberculosis 1.400 1.3e-07
active Crohn's disease 4.876 3.8e-05
active ulcerative colitis 4.505 1.2e-04
adult high grade glioma 1.400 1.5e-02
Astrocytoma, Pilocytic 1.600 2.1e-04
atypical teratoid / rhabdoid tumor 1.100 4.4e-02
autosomal dominant Emery-Dreifuss muscul... 1.214 1.7e-02
Barrett's esophagus 3.200 2.5e-02
Becker muscular dystrophy 2.086 2.2e-03
Breast cancer 3.400 2.2e-02
breast carcinoma 1.100 4.8e-02
chronic kidney disease 2.400 3.9e-02
Chronic Lymphocytic Leukemia -2.369 2.0e-03
chronic rhinosinusitis 2.718 3.2e-02
cutaneous lupus erythematosus 1.400 7.3e-03
dermatomyositis 2.400 2.6e-03
diabetes mellitus -2.800 1.3e-02
Duchenne muscular dystrophy 3.021 1.8e-10
ductal carcinoma in situ 1.700 4.5e-02
ependymoma 1.200 7.3e-04
esophageal adenocarcinoma 3.500 1.9e-02
glioblastoma 1.700 2.4e-03
group 3 medulloblastoma 1.400 2.6e-03
interstitial cystitis 4.200 1.4e-02
intraductal papillary-mucinous adenoma (... 3.900 3.6e-03
intraductal papillary-mucinous carcinoma... 2.000 4.5e-02
invasive ductal carcinoma 2.762 2.1e-04
juvenile dermatomyositis 1.583 3.3e-06
limb girdle muscular dystrophy 2A 1.949 6.4e-05
lung adenocarcinoma -1.700 9.4e-04
lung cancer -4.000 2.3e-06
lung carcinoma -3.600 9.2e-28
nephrosclerosis 1.472 3.1e-02
non primary Sjogren syndrome sicca 1.500 5.0e-02
non-small cell lung cancer -1.654 1.2e-05
osteosarcoma -1.675 2.8e-02
ovarian cancer -2.900 2.8e-07
pancreatic cancer 2.000 6.9e-03
primitive neuroectodermal tumor 2.200 2.2e-02
psoriasis 1.500 4.3e-08
Waldenstrons macroglobulinemia 3.229 9.7e-03

PDB (208)

Gene RIF (58)

AA Sequence

MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRST      1 - 70
DYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVR     71 - 140
QYVQGCGV                                                                  141 - 148
//

Text Mined References (101)

PMID Year Title