Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.13
PubTator Score 0.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adrenocortical carcinoma -1.044 1.8e-06
adult high grade glioma -1.400 3.6e-03
astrocytic glioma -1.500 1.5e-02
atypical teratoid / rhabdoid tumor -1.700 1.4e-06
Breast cancer -1.500 7.8e-07
ependymoma -1.600 2.3e-02
glioblastoma -1.200 1.8e-04
malignant mesothelioma -2.300 3.1e-07
medulloblastoma -1.500 1.1e-03
medulloblastoma, large-cell -2.000 1.5e-03
oligodendroglioma 1.400 2.0e-03
osteosarcoma -3.100 2.0e-07
ovarian cancer -1.700 6.1e-23
pancreatic cancer -1.200 1.8e-03
Pick disease -1.100 4.7e-04
primary pancreatic ductal adenocarcinoma -1.033 8.4e-03
primitive neuroectodermal tumor -1.600 5.0e-03
psoriasis -3.600 8.5e-06

 Compartment GO Term (1)

Gene RIF (1)

AA Sequence

MAPLPGAELVRRPLQLYRYLLRCCQQLPTKGIQQHYKHAVRQSFRVHSDEDNPERIQQIIKRAIEDADWI      1 - 70
MNKYKKQN                                                                   71 - 78
//

Text Mined References (4)

PMID Year Title