Property Summary

NCBI Gene PubMed Count 11
PubMed Score 10.72
PubTator Score 8.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Obesity 678 3.088 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
acute myeloid leukemia 1.400 2.3e-02
Multiple myeloma 1.730 3.2e-04
ovarian cancer -1.200 1.5e-04
pancreatic ductal adenocarcinoma liver m... -1.454 7.3e-03

Gene RIF (5)

AA Sequence

MTTATRQEVLGLYRSIFRLARKWQATSGQMEDTIKEKQYILNEARTLFRKNKNLTDTDLIKQCIDECTAR      1 - 70
IEIGLHYKIPYPRPIHLPPMGLTPLRGRGLRSQEKLRKLSKPVYLRSHDEVS                       71 - 122
//

Text Mined References (12)

PMID Year Title